Masavibart / 8j1q

A4DAB166_8j1q_B_A | Source PDB: 8j1q | Chains: B, A | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5885
Max Score
2.0012
Min Score
-2.8598
Total Score
-135.94
Score CDR
-0.4033
Score non-CDR
-0.641

Calculation Parameters

Chain Sequence(s) QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQSEDEADYYCNSLTSISTWVFGGGTKLTVLG input.pdb
Selected Chain(s) B (Heavy), A (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8598
Maximum Score 2.0012
Average Score -0.5885
Total Score -135.9408

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q B -1.3768 Soluble
2 V B -0.8446 Soluble
3 Q B -1.0823 Soluble
4 L B 0.0000 Buried
5 V B 0.9727 Aggregation-prone
6 E B 0.4049 Aggregation-prone
7 S B -0.0866 Soluble
8 G B -0.0804 Soluble
9 G B -0.0270 Soluble
11 G B 0.5355 Aggregation-prone
12 V B 1.4787 Aggregation-prone
13 V B -0.1290 Soluble
14 Q B -1.5627 Soluble
15 P B -1.6187 Soluble
16 G B -1.8253 Soluble
17 R B -2.5613 Soluble
18 S B -1.9657 Soluble
19 L B -1.6641 Soluble
20 R B -2.1915 Soluble
21 L B 0.0000 Buried
22 S B -0.4196 Soluble
23 C B 0.0000 Buried
24 A B -0.0349 Soluble
25 A B 0.0000 Buried
26 S B -0.5908 Soluble
27 G B -0.8553 Soluble
28 F B -0.5553 Soluble
29 T B -0.6553 Soluble
30 F B 0.0000 Buried
35 S B -0.9947 Soluble
36 N B -1.5067 Soluble
37 Y B -0.7936 Soluble
38 A B -0.4117 Soluble
39 M B 0.0000 Buried
40 Y B 0.0000 Buried
41 W B 0.0000 Buried
42 V B 0.0000 Buried
43 R B -0.3938 Soluble
44 Q B -0.6885 Soluble
45 A B -1.0722 Soluble
46 P B -0.8502 Soluble
47 G B -1.5157 Soluble
48 K B -2.2789 Soluble
49 G B -1.4947 Soluble
50 L B 0.0000 Buried
51 E B -0.9599 Soluble
52 W B 0.0000 Buried
53 V B 0.0000 Buried
54 A B 0.0000 Buried
55 V B 0.0000 Buried
56 I B 0.0000 Buried
57 S B -0.9415 Soluble
58 Y B -0.5106 Soluble
59 D B -1.9687 Soluble
62 G B -1.4939 Soluble
63 S B -1.4062 Soluble
64 N B -1.8072 Soluble
65 K B -1.2323 Soluble
66 Y B -0.1780 Soluble
67 Y B -0.8716 Soluble
68 A B -1.2656 Soluble
69 D B -2.4125 Soluble
70 S B -1.7038 Soluble
71 V B 0.0000 Buried
72 K B -2.8598 Soluble
74 G B -2.2275 Soluble
75 R B -2.2925 Soluble
76 F B 0.0000 Buried
77 T B -1.1298 Soluble
78 I B 0.0000 Buried
79 S B -0.8202 Soluble
80 R B -0.9537 Soluble
81 D B -1.6419 Soluble
82 N B -1.9898 Soluble
83 S B -1.6192 Soluble
84 K B -2.3128 Soluble
85 N B -1.7263 Soluble
86 T B 0.0000 Buried
87 L B 0.0000 Buried
88 Y B -0.6068 Soluble
89 L B 0.0000 Buried
90 Q B -1.6982 Soluble
91 M B 0.0000 Buried
92 N B -2.0601 Soluble
93 S B -1.6776 Soluble
94 L B 0.0000 Buried
95 R B -1.6608 Soluble
96 T B -1.4378 Soluble
97 E B -2.0202 Soluble
98 D B 0.0000 Buried
99 T B -0.2034 Soluble
100 A B 0.0000 Buried
101 V B 0.7247 Aggregation-prone
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 A B 0.0000 Buried
106 S B 0.0000 Buried
107 G B 0.0000 Buried
108 S B -0.8226 Soluble
109 D B -1.4514 Soluble
110 Y B 0.1680 Aggregation-prone
111 G B -0.6189 Soluble
112 D B -1.6606 Soluble
113 Y B -0.4068 Soluble
114 L B 0.0000 Buried
115 L B 0.0000 Buried
116 V B -0.0348 Soluble
117 Y B 0.1434 Aggregation-prone
118 W B 0.0000 Buried
119 G B -0.6235 Soluble
120 Q B -1.2381 Soluble
121 G B -0.2083 Soluble
122 T B 0.5240 Aggregation-prone
123 L B 1.5263 Aggregation-prone
124 V B 0.0000 Buried
125 T B 0.4665 Aggregation-prone
126 V B 0.0000 Buried
127 S B -0.4103 Soluble
128 S B -0.4440 Soluble
129 A B -0.1112 Soluble
130 S B -0.0800 Soluble
3 A A 0.0344 Aggregation-prone
4 L A 0.0509 Aggregation-prone
5 T A -0.1954 Soluble
6 Q A -0.3578 Soluble
7 P A -0.4918 Soluble
8 A A -0.5025 Soluble
9 S A -0.8429 Soluble
11 V A -0.4114 Soluble
12 S A -0.2359 Soluble
13 G A 0.0151 Aggregation-prone
14 S A -0.1934 Soluble
15 P A -0.8419 Soluble
16 G A -1.2951 Soluble
17 Q A -1.3547 Soluble
18 S A -0.9189 Soluble
19 I A 0.0000 Buried
20 T A -0.1834 Soluble
21 I A 0.0000 Buried
22 S A -0.3887 Soluble
23 C A 0.0000 Buried
24 T A -0.4604 Soluble
25 G A -0.3128 Soluble
26 T A -0.4656 Soluble
27 S A -0.6327 Soluble
28 S A -0.4925 Soluble
29 D A 0.0000 Buried
30 V A 0.0000 Buried
31 G A -1.0189 Soluble
35 G A -0.6843 Soluble
36 Y A 0.0481 Aggregation-prone
37 N A -0.9067 Soluble
38 Y A 0.1539 Aggregation-prone
39 V A 0.0000 Buried
40 S A 0.0000 Buried
41 W A 0.0000 Buried
42 Y A 0.0000 Buried
43 Q A 0.0000 Buried
44 Q A 0.0000 Buried
45 H A -1.8270 Soluble
46 P A -1.3266 Soluble
47 G A -1.4870 Soluble
48 K A -2.4940 Soluble
49 A A -1.6632 Soluble
50 P A 0.0000 Buried
51 K A -1.3619 Soluble
52 L A 0.0000 Buried
53 M A 0.0000 Buried
54 I A 0.0000 Buried
55 Y A -0.4590 Soluble
56 D A -0.5781 Soluble
57 V A -0.6220 Soluble
65 S A -1.2083 Soluble
66 K A -2.0215 Soluble
67 R A -1.6628 Soluble
68 P A -0.7436 Soluble
69 S A -0.8162 Soluble
70 G A -0.6883 Soluble
71 V A -0.6432 Soluble
72 S A -0.9445 Soluble
74 N A -1.7437 Soluble
75 R A -1.3297 Soluble
76 F A 0.0000 Buried
77 S A -1.0125 Soluble
78 G A -0.7652 Soluble
79 S A -0.7699 Soluble
80 K A -1.1288 Soluble
83 S A -0.9261 Soluble
84 G A -1.2650 Soluble
85 N A -1.2511 Soluble
86 T A -0.8181 Soluble
87 A A 0.0000 Buried
88 S A -0.3674 Soluble
89 L A 0.0000 Buried
90 T A -0.3587 Soluble
91 I A 0.0000 Buried
92 S A -1.1537 Soluble
93 G A -1.1400 Soluble
94 L A 0.0000 Buried
95 Q A -2.0028 Soluble
96 S A -1.6768 Soluble
97 E A -2.4855 Soluble
98 D A 0.0000 Buried
99 E A -2.0643 Soluble
100 A A 0.0000 Buried
101 D A -1.2929 Soluble
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 N A 0.0000 Buried
106 S A 0.0000 Buried
107 L A 0.6008 Aggregation-prone
108 T A 0.0000 Buried
109 S A 0.8653 Aggregation-prone
113 I A 2.0012 Aggregation-prone
114 S A 1.1260 Aggregation-prone
115 T A 0.4316 Aggregation-prone
116 W A 0.0000 Buried
117 V A 0.1675 Aggregation-prone
118 F A 0.0000 Buried
119 G A 0.0000 Buried
120 G A -0.7220 Soluble
121 G A -1.2221 Soluble
122 T A 0.0000 Buried
123 K A -2.0722 Soluble
124 L A 0.0000 Buried
125 T A -0.7608 Soluble
126 V A 0.0611 Aggregation-prone
127 L A 1.2720 Aggregation-prone
128 G A 0.2794 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6476 2.5479 CSV PDB
4.5 -0.6807 2.5479 CSV PDB
5.0 -0.7173 2.5479 CSV PDB
5.5 -0.7522 2.5479 CSV PDB
6.0 -0.7783 2.5479 CSV PDB
6.5 -0.7892 2.5479 CSV PDB
7.0 -0.7839 2.5479 CSV PDB
7.5 -0.7673 2.5479 CSV PDB
8.0 -0.7434 2.5478 CSV PDB
8.5 -0.7133 2.5478 CSV PDB
9.0 -0.6773 2.5475 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH