Bimagrumab / 5nh3

A4DAB047_5nh3_H_L | Source PDB: 5nh3 | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4537
Max Score
1.7518
Min Score
-3.419
Total Score
-101.62
Score CDR
-0.0005
Score non-CDR
-0.574

Calculation Parameters

Chain Sequence(s) VQLVQSGAEVKKPGASVKVSCKASGYTFTSSYINWVRQAPGQGLEWMGTINPVSGSTSYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGWFDYWGQGTLVTVSSALTQPASVSGSPGQSITISCTGTSSDVGSYNYVNWYQQHPGKAPKLMIYGVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCGTFAGGSYYGVFGGGTKLTVLW input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.419
Maximum Score 1.7518
Average Score -0.4537
Total Score -101.6227

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V H 0.9490 Aggregation-prone
3 Q H -0.1394 Soluble
4 L H 0.0000 Buried
5 V H 0.2023 Aggregation-prone
6 Q H 0.0000 Buried
7 S H -0.5507 Soluble
8 G H -0.5049 Soluble
9 A H 0.2160 Aggregation-prone
11 E H -0.1267 Soluble
12 V H 0.8989 Aggregation-prone
13 K H -1.0276 Soluble
14 K H -2.3089 Soluble
15 P H -2.5572 Soluble
16 G H -1.9929 Soluble
17 A H -1.6191 Soluble
18 S H -1.7255 Soluble
19 V H 0.0000 Buried
20 K H -2.0229 Soluble
21 V H 0.0000 Buried
22 S H -0.6763 Soluble
23 C H 0.0000 Buried
24 K H -0.6555 Soluble
25 A H 0.0000 Buried
26 S H -0.0446 Soluble
27 G H -0.0390 Soluble
28 Y H 0.1349 Aggregation-prone
29 T H -0.0292 Soluble
30 F H 0.0000 Buried
35 T H 0.3554 Aggregation-prone
36 S H 0.0189 Aggregation-prone
37 S H 0.0684 Aggregation-prone
38 Y H 0.1520 Aggregation-prone
39 I H 0.0000 Buried
40 N H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H -0.3501 Soluble
44 Q H -0.6067 Soluble
45 A H -0.9581 Soluble
46 P H -1.0044 Soluble
47 G H -1.2459 Soluble
48 Q H -1.7407 Soluble
49 G H -1.2267 Soluble
50 L H 0.0000 Buried
51 E H -0.7531 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 T H 0.0000 Buried
56 I H 0.0000 Buried
57 N H -0.0615 Soluble
58 P H 0.0000 Buried
59 V H 1.4118 Aggregation-prone
62 S H 0.4178 Aggregation-prone
63 G H -0.1022 Soluble
64 S H -0.2074 Soluble
65 T H -0.2871 Soluble
66 S H -0.1338 Soluble
67 Y H -0.6089 Soluble
68 A H 0.0000 Buried
69 Q H -2.3728 Soluble
70 K H -2.6705 Soluble
71 F H 0.0000 Buried
72 Q H -2.1944 Soluble
74 G H -1.7043 Soluble
75 R H -1.6738 Soluble
76 V H 0.0000 Buried
77 T H -0.7827 Soluble
78 M H 0.0000 Buried
79 T H -0.6336 Soluble
80 R H -0.7339 Soluble
81 D H -0.8609 Soluble
82 T H -0.0049 Soluble
83 S H 0.0701 Aggregation-prone
84 I H 0.7000 Aggregation-prone
85 S H -0.0976 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.8289 Soluble
89 M H 0.0000 Buried
90 E H -1.4915 Soluble
91 L H 0.0000 Buried
92 S H -1.8455 Soluble
93 R H -2.7354 Soluble
94 L H 0.0000 Buried
95 R H -3.4190 Soluble
96 S H -2.3702 Soluble
97 D H -2.5269 Soluble
98 D H 0.0000 Buried
99 T H -0.7805 Soluble
100 A H 0.0000 Buried
101 V H 0.3279 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H -0.0404 Soluble
107 G H -0.0416 Soluble
108 G H 0.0000 Buried
114 W H 0.3290 Aggregation-prone
115 F H 0.0000 Buried
116 D H -0.2913 Soluble
117 Y H 0.1551 Aggregation-prone
118 W H -0.1621 Soluble
119 G H 0.0000 Buried
120 Q H -1.2708 Soluble
121 G H -0.5482 Soluble
122 T H 0.0000 Buried
123 L H 0.9856 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.1660 Soluble
126 V H 0.0000 Buried
127 S H -1.1096 Soluble
2 S L -0.0985 Soluble
3 A L -0.1286 Soluble
4 L L 0.0000 Buried
5 T L -0.3221 Soluble
6 Q L -0.4730 Soluble
7 P L -0.3562 Soluble
8 A L -0.4156 Soluble
9 S L -0.4815 Soluble
11 V L -0.0483 Soluble
12 S L 0.0230 Aggregation-prone
13 G L 0.0000 Buried
14 S L 0.0960 Aggregation-prone
15 P L -0.4111 Soluble
16 G L -1.0962 Soluble
17 Q L -1.0713 Soluble
18 S L -0.6607 Soluble
19 I L -0.1220 Soluble
20 T L -0.0118 Soluble
21 I L 0.0000 Buried
22 S L -0.2728 Soluble
23 C L 0.0000 Buried
24 T L -0.5156 Soluble
25 G L -0.5864 Soluble
26 T L -0.7312 Soluble
27 S L -0.7790 Soluble
28 S L -0.6213 Soluble
29 D L -0.7322 Soluble
30 V L 0.0000 Buried
31 G L -1.0973 Soluble
35 S L -0.5624 Soluble
36 Y L -0.0676 Soluble
37 N L -0.9232 Soluble
38 Y L 0.0635 Aggregation-prone
39 V L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 H L -1.8899 Soluble
46 P L -1.4040 Soluble
47 G L -1.6285 Soluble
48 K L -2.5360 Soluble
49 A L -1.5955 Soluble
50 P L 0.0000 Buried
51 K L -1.6190 Soluble
52 L L 0.0000 Buried
53 M L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.6673 Soluble
56 G L -0.7196 Soluble
57 V L 0.0000 Buried
65 S L -1.4354 Soluble
66 K L -2.0578 Soluble
67 R L -1.6609 Soluble
68 P L -1.0474 Soluble
69 S L -0.8382 Soluble
70 G L -0.7385 Soluble
71 V L -0.8255 Soluble
72 S L -1.0237 Soluble
74 N L -1.7221 Soluble
75 R L -1.2968 Soluble
76 F L 0.0000 Buried
77 S L -0.9963 Soluble
78 G L -0.7928 Soluble
79 S L -0.9437 Soluble
80 K L -1.1253 Soluble
83 S L -0.8628 Soluble
84 G L -1.0779 Soluble
85 N L -1.0979 Soluble
86 T L -0.7711 Soluble
87 A L 0.0000 Buried
88 S L -0.3637 Soluble
89 L L 0.0000 Buried
90 T L -0.2353 Soluble
91 I L 0.0000 Buried
92 S L -0.9760 Soluble
93 G L -1.0577 Soluble
94 L L 0.0000 Buried
95 Q L -1.7402 Soluble
96 A L -1.1743 Soluble
97 E L -2.3159 Soluble
98 D L 0.0000 Buried
99 E L -1.6953 Soluble
100 A L 0.0000 Buried
101 D L -1.2518 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 G L 0.0000 Buried
106 T L 0.5460 Aggregation-prone
107 F L 0.7252 Aggregation-prone
108 A L 0.0000 Buried
109 G L 0.0000 Buried
110 G L -0.2413 Soluble
113 S L 0.0753 Aggregation-prone
114 Y L 0.8994 Aggregation-prone
115 Y L 1.4513 Aggregation-prone
116 G L 0.8968 Aggregation-prone
117 V L 0.5547 Aggregation-prone
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 G L -0.9013 Soluble
121 G L -0.8811 Soluble
122 T L 0.0000 Buried
123 K L -1.1913 Soluble
124 L L 0.0000 Buried
125 T L -0.0953 Soluble
126 V L 0.0000 Buried
127 L L 1.6458 Aggregation-prone
128 W L 1.7518 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5424 4.2705 CSV PDB
4.5 -0.5609 4.2705 CSV PDB
5.0 -0.5821 4.2705 CSV PDB
5.5 -0.6004 4.2705 CSV PDB
6.0 -0.6093 4.2705 CSV PDB
6.5 -0.6037 4.2705 CSV PDB
7.0 -0.5842 4.2705 CSV PDB
7.5 -0.5562 4.2705 CSV PDB
8.0 -0.524 4.2705 CSV PDB
8.5 -0.489 4.2705 CSV PDB
9.0 -0.4514 4.2705 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH