Tusamitamab / 8bw0

A4DAB280_8bw0_H_L | Source PDB: 8bw0 | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4896
Max Score
1.9326
Min Score
-3.1195
Total Score
-108.21
Score CDR
0.1209
Score non-CDR
-0.6546

Calculation Parameters

Chain Sequence(s) VQLQESGPGLVKPGGSLSLSCAASGFVFSSYDMSWVRQTPERGLEWVAYISSGGGITYAPSTVKGRFTVSRDNAKNTLYLQMNSLTSEDTAVYYCAAHYFGSSGPFAYWGQGTLVTVDIQMTQSPASLSASVGDRVTITCRASENIFSYLAWYQQKPGKSPKLLVYNTRTLAEGVPSRFSGSGSGTDFSLTISSLQPEDFATYYCQHHYGTPFTFGSGTKL input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1195
Maximum Score 1.9326
Average Score -0.4896
Total Score -108.2101

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V H 1.2370 Aggregation-prone
3 Q H -0.7806 Soluble
4 L H 0.0000 Buried
5 Q H -1.4710 Soluble
6 E H 0.0000 Buried
7 S H -0.3926 Soluble
8 G H -0.1043 Soluble
9 P H 0.0221 Aggregation-prone
11 G H 0.8136 Aggregation-prone
12 L H 1.4345 Aggregation-prone
13 V H 0.0294 Aggregation-prone
14 K H -1.5083 Soluble
15 P H -1.1725 Soluble
16 G H -1.3899 Soluble
17 G H -1.3316 Soluble
18 S H -1.3770 Soluble
19 L H 0.0000 Buried
20 S H -0.7529 Soluble
21 L H 0.0000 Buried
22 S H -0.3612 Soluble
23 C H 0.0000 Buried
24 A H -0.9424 Soluble
25 A H -0.4780 Soluble
26 S H -0.0726 Soluble
27 G H 0.3701 Aggregation-prone
28 F H 1.1510 Aggregation-prone
29 V H 1.8647 Aggregation-prone
30 F H 0.0000 Buried
35 S H -0.0499 Soluble
36 S H 0.2106 Aggregation-prone
37 Y H 0.6567 Aggregation-prone
38 D H -0.0470 Soluble
39 M H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H -0.1537 Soluble
44 Q H -0.6239 Soluble
45 T H 0.0000 Buried
46 P H -1.4866 Soluble
47 E H -2.5843 Soluble
48 R H -2.5344 Soluble
49 G H -1.5036 Soluble
50 L H 0.0000 Buried
51 E H -0.7134 Soluble
52 W H 0.0000 Buried
53 V H 0.0000 Buried
54 A H 0.0000 Buried
55 Y H 0.0000 Buried
56 I H 0.0000 Buried
57 S H 0.0727 Aggregation-prone
58 S H -0.4934 Soluble
59 G H -0.7968 Soluble
62 G H -0.3942 Soluble
63 G H 0.2570 Aggregation-prone
64 I H 1.7141 Aggregation-prone
65 T H 1.0554 Aggregation-prone
66 Y H 0.8119 Aggregation-prone
67 A H -0.1042 Soluble
68 P H -0.3154 Soluble
69 S H -0.7903 Soluble
70 T H -0.3701 Soluble
71 V H -0.5492 Soluble
72 K H -1.6564 Soluble
74 G H -1.2761 Soluble
75 R H -1.2117 Soluble
76 F H -0.5860 Soluble
77 T H -0.3683 Soluble
78 V H 0.1552 Aggregation-prone
79 S H -0.3615 Soluble
80 R H -0.9560 Soluble
81 D H -1.6138 Soluble
82 N H -1.3389 Soluble
83 A H -1.3321 Soluble
84 K H -2.1940 Soluble
85 N H -1.3051 Soluble
86 T H -1.1255 Soluble
87 L H 0.0000 Buried
88 Y H 0.0255 Aggregation-prone
89 L H 0.0000 Buried
90 Q H -1.1195 Soluble
91 M H 0.0000 Buried
92 N H -1.7882 Soluble
93 S H -1.3007 Soluble
94 L H 0.0000 Buried
95 T H -1.1847 Soluble
96 S H -1.0790 Soluble
97 E H -2.0323 Soluble
98 D H 0.0000 Buried
99 T H -0.1327 Soluble
100 A H 0.0000 Buried
101 V H 0.6894 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 A H 0.0000 Buried
107 H H 0.0000 Buried
108 Y H 1.1062 Aggregation-prone
109 F H 1.9326 Aggregation-prone
110 G H 0.7680 Aggregation-prone
111 S H 0.3978 Aggregation-prone
112 S H 0.6027 Aggregation-prone
113 G H 0.0000 Buried
114 P H 0.0000 Buried
115 F H 0.0000 Buried
116 A H 0.0000 Buried
117 Y H 0.4167 Aggregation-prone
118 W H -0.2846 Soluble
119 G H 0.0000 Buried
120 Q H -1.8466 Soluble
121 G H -0.7961 Soluble
122 T H 0.2069 Aggregation-prone
123 L H 1.5561 Aggregation-prone
124 V H 0.0000 Buried
125 T H 0.5258 Aggregation-prone
126 V H -0.1511 Soluble
1 D L -2.3299 Soluble
2 I L -1.8858 Soluble
3 Q L -2.2370 Soluble
4 M L 0.0000 Buried
5 T L -1.1583 Soluble
6 Q L 0.0000 Buried
7 S L -0.6095 Soluble
8 P L -0.2905 Soluble
9 A L -0.3407 Soluble
10 S L -0.4343 Soluble
11 L L 0.0988 Aggregation-prone
12 S L -0.2560 Soluble
13 A L -0.4464 Soluble
14 S L -0.4114 Soluble
15 V L 0.0867 Aggregation-prone
16 G L -0.9261 Soluble
17 D L -2.0572 Soluble
18 R L -2.5380 Soluble
19 V L 0.0000 Buried
20 T L -0.6585 Soluble
21 I L 0.0000 Buried
22 T L -0.7276 Soluble
23 C L 0.0000 Buried
24 R L -2.7731 Soluble
25 A L 0.0000 Buried
26 S L -2.5013 Soluble
27 E L -3.1195 Soluble
28 N L -1.9650 Soluble
29 I L 0.0000 Buried
36 F L 1.3283 Aggregation-prone
37 S L 0.4472 Aggregation-prone
38 Y L 0.6134 Aggregation-prone
39 L L 0.0000 Buried
40 A L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L -0.7588 Soluble
44 Q L -1.3287 Soluble
45 K L -1.6553 Soluble
46 P L -1.2032 Soluble
47 G L -1.6844 Soluble
48 K L -2.6130 Soluble
49 S L -1.7611 Soluble
50 P L 0.0000 Buried
51 K L -1.3329 Soluble
52 L L -0.5176 Soluble
53 L L 0.0000 Buried
54 V L 0.0000 Buried
55 Y L -0.3433 Soluble
56 N L -0.5968 Soluble
57 T L 0.0000 Buried
65 R L -2.0041 Soluble
66 T L -1.0904 Soluble
67 L L -0.6412 Soluble
68 A L 0.0000 Buried
69 E L -1.8635 Soluble
70 G L -1.1831 Soluble
71 V L -0.5655 Soluble
72 P L -0.5653 Soluble
74 S L -0.5578 Soluble
75 R L -0.9963 Soluble
76 F L 0.0000 Buried
77 S L -0.8205 Soluble
78 G L -0.9235 Soluble
79 S L -1.0645 Soluble
80 G L -0.8348 Soluble
83 S L -0.2371 Soluble
84 G L -0.7281 Soluble
85 T L -1.7142 Soluble
86 D L -1.9887 Soluble
87 F L 0.0000 Buried
88 S L -0.6837 Soluble
89 L L 0.0000 Buried
90 T L -0.7056 Soluble
91 I L 0.0000 Buried
92 S L -1.6836 Soluble
93 S L -1.3394 Soluble
94 L L -1.3738 Soluble
95 Q L -1.4578 Soluble
96 P L -1.4806 Soluble
97 E L -2.6977 Soluble
98 D L -2.5032 Soluble
99 F L -1.4828 Soluble
100 A L 0.0000 Buried
101 T L -0.5997 Soluble
102 Y L 0.0000 Buried
103 Y L -0.2568 Soluble
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 H L 0.0000 Buried
107 H L 0.0000 Buried
108 Y L 0.8801 Aggregation-prone
109 G L 0.2447 Aggregation-prone
114 T L -0.0745 Soluble
115 P L -0.2767 Soluble
116 F L 0.0000 Buried
117 T L -0.5893 Soluble
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 S L -0.7345 Soluble
121 G L -0.5325 Soluble
122 T L 0.0000 Buried
123 K L -1.1003 Soluble
124 L L -0.4945 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4604 4.1229 CSV PDB
4.5 -0.4972 4.1159 CSV PDB
5.0 -0.5396 4.1086 CSV PDB
5.5 -0.5797 4.1013 CSV PDB
6.0 -0.6097 4.0939 CSV PDB
6.5 -0.6246 4.0866 CSV PDB
7.0 -0.6247 4.0794 CSV PDB
7.5 -0.6147 4.0727 CSV PDB
8.0 -0.5989 4.0671 CSV PDB
8.5 -0.5785 4.0632 CSV PDB
9.0 -0.553 4.0612 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH