Cemiplimab / 7wvm

A4DAB061_7wvm_A_B | Source PDB: 7wvm | Chains: A, B | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5631
Max Score
2.5767
Min Score
-2.6014
Total Score
-126.14
Score CDR
-0.5232
Score non-CDR
-0.5729

Calculation Parameters

Chain Sequence(s) EVQLLESGGVLVQPGGSLRLSCAASGFTFSNFGMTWVRQAPGKGLEWVSGISGGGRDTYFADSVKGRFTISRDNSKNTLYLQMNSLKGEDTAVYYCVKWGNIYFDYWGQGTLVTVSSDIQMTQSPSSLSASVGDSITITCRASLSINTFLNWYQQKPGKAPNLLIYAASSLHGGVPSRFSGSGSGTDFTLTIRTLQPEDFATYYCQQSSNTPFTFGPGTVVDFR input.pdb
Selected Chain(s) A (Heavy), B (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.6014
Maximum Score 2.5767
Average Score -0.5631
Total Score -126.137

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E A -2.1932 Soluble
2 V A -1.4183 Soluble
3 Q A -1.4264 Soluble
4 L A 0.0000 Buried
5 L A 0.7767 Aggregation-prone
6 E A 0.1948 Aggregation-prone
7 S A 0.1500 Aggregation-prone
8 G A 0.1102 Aggregation-prone
9 G A 1.2027 Aggregation-prone
11 V A 2.5767 Aggregation-prone
12 L A 2.2352 Aggregation-prone
13 V A 0.0000 Buried
14 Q A -1.2561 Soluble
15 P A -1.7359 Soluble
16 G A -1.5250 Soluble
17 G A -1.2189 Soluble
18 S A -1.3248 Soluble
19 L A -0.5822 Soluble
20 R A -1.6448 Soluble
21 L A 0.0000 Buried
22 S A -0.2688 Soluble
23 C A 0.0000 Buried
24 A A -0.1110 Soluble
25 A A 0.0000 Buried
26 S A -1.0606 Soluble
27 G A -1.2878 Soluble
28 F A -0.6236 Soluble
29 T A -0.4685 Soluble
30 F A 0.0000 Buried
35 S A -1.3208 Soluble
36 N A -1.2462 Soluble
37 F A -0.4206 Soluble
38 G A 0.0000 Buried
39 M A 0.0000 Buried
40 T A 0.0000 Buried
41 W A 0.0000 Buried
42 V A 0.0000 Buried
43 R A 0.0000 Buried
44 Q A -0.7389 Soluble
45 A A -1.1653 Soluble
46 P A -1.0597 Soluble
47 G A -1.4819 Soluble
48 K A -2.2902 Soluble
49 G A -1.4843 Soluble
50 L A 0.0000 Buried
51 E A -1.1727 Soluble
52 W A 0.0000 Buried
53 V A 0.0000 Buried
54 S A 0.0000 Buried
55 G A 0.0000 Buried
56 I A 0.0000 Buried
57 S A -1.0571 Soluble
58 G A 0.0000 Buried
59 G A -1.6765 Soluble
62 G A -1.8347 Soluble
63 R A -2.4179 Soluble
64 D A -1.5429 Soluble
65 T A -0.5315 Soluble
66 Y A 0.1297 Aggregation-prone
67 F A -0.4295 Soluble
68 A A 0.0000 Buried
69 D A -2.3094 Soluble
70 S A -1.7687 Soluble
71 V A 0.0000 Buried
72 K A -2.4284 Soluble
74 G A -1.8370 Soluble
75 R A -1.6235 Soluble
76 F A 0.0000 Buried
77 T A -0.9091 Soluble
78 I A 0.0000 Buried
79 S A -0.8360 Soluble
80 R A -1.4243 Soluble
81 D A -2.0413 Soluble
82 N A -2.1111 Soluble
83 S A -1.7550 Soluble
84 K A -2.4999 Soluble
85 N A -1.9011 Soluble
86 T A -1.0979 Soluble
87 L A 0.0000 Buried
88 Y A -0.4542 Soluble
89 L A 0.0000 Buried
90 Q A -1.3630 Soluble
91 M A 0.0000 Buried
92 N A -2.0233 Soluble
93 S A -1.3519 Soluble
94 L A 0.0000 Buried
95 K A -2.3111 Soluble
96 G A -2.1339 Soluble
97 E A -2.4135 Soluble
98 D A 0.0000 Buried
99 T A -0.5222 Soluble
100 A A 0.0000 Buried
101 V A 0.5779 Aggregation-prone
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 V A 0.0000 Buried
106 K A 0.0000 Buried
107 W A -0.1441 Soluble
108 G A -0.9051 Soluble
109 N A -1.1417 Soluble
113 I A -0.0772 Soluble
114 Y A 0.0475 Aggregation-prone
115 F A 0.0000 Buried
116 D A -0.2327 Soluble
117 Y A -0.0119 Soluble
118 W A -0.3568 Soluble
119 G A 0.0000 Buried
120 Q A -1.3419 Soluble
121 G A 0.0000 Buried
122 T A 0.0000 Buried
123 L A 1.9284 Aggregation-prone
124 V A 0.0000 Buried
125 T A 0.7199 Aggregation-prone
126 V A 0.0000 Buried
127 S A -0.6757 Soluble
128 S A -0.5883 Soluble
1 D B -2.2071 Soluble
2 I B 0.0000 Buried
3 Q B -1.7112 Soluble
4 M B 0.0000 Buried
5 T B -0.9105 Soluble
6 Q B 0.0000 Buried
7 S B -0.2541 Soluble
8 P B -0.0842 Soluble
9 S B -0.1195 Soluble
10 S B -0.2052 Soluble
11 L B -0.1129 Soluble
12 S B -0.6447 Soluble
13 A B 0.0000 Buried
14 S B -0.3895 Soluble
15 V B 0.1698 Aggregation-prone
16 G B -0.8562 Soluble
17 D B -1.4552 Soluble
18 S B -1.3985 Soluble
19 I B 0.0000 Buried
20 T B -0.5162 Soluble
21 I B 0.0000 Buried
22 T B -0.6777 Soluble
23 C B 0.0000 Buried
24 R B -1.6257 Soluble
25 A B 0.0000 Buried
26 S B -0.7529 Soluble
27 L B 0.0454 Aggregation-prone
28 S B -0.3837 Soluble
29 I B 0.0000 Buried
36 N B -1.3603 Soluble
37 T B -0.3263 Soluble
38 F B 0.4722 Aggregation-prone
39 L B 0.0000 Buried
40 N B 0.0000 Buried
41 W B 0.0000 Buried
42 Y B 0.0000 Buried
43 Q B -0.6131 Soluble
44 Q B 0.0000 Buried
45 K B -1.5954 Soluble
46 P B -1.2274 Soluble
47 G B -1.7156 Soluble
48 K B -2.6014 Soluble
49 A B -1.6178 Soluble
50 P B 0.0000 Buried
51 N B -1.1541 Soluble
52 L B 0.0000 Buried
53 L B 0.0000 Buried
54 I B 0.0000 Buried
55 Y B 0.4776 Aggregation-prone
56 A B 0.3066 Aggregation-prone
57 A B 0.0000 Buried
65 S B -0.0901 Soluble
66 S B 0.1217 Aggregation-prone
67 L B 0.2650 Aggregation-prone
68 H B -0.2951 Soluble
69 G B -0.6744 Soluble
70 G B -0.6931 Soluble
71 V B 0.0000 Buried
72 P B -0.4205 Soluble
74 S B -0.6415 Soluble
75 R B -1.0270 Soluble
76 F B 0.0000 Buried
77 S B -0.4566 Soluble
78 G B -0.2132 Soluble
79 S B -0.7089 Soluble
80 G B -1.3353 Soluble
83 S B -1.4112 Soluble
84 G B -1.1978 Soluble
85 T B -1.3542 Soluble
86 D B -2.3622 Soluble
87 F B 0.0000 Buried
88 T B -0.7307 Soluble
89 L B 0.0000 Buried
90 T B -0.6692 Soluble
91 I B 0.0000 Buried
92 R B -2.2477 Soluble
93 T B -1.3599 Soluble
94 L B 0.0000 Buried
95 Q B -1.2136 Soluble
96 P B -0.7773 Soluble
97 E B -1.9487 Soluble
98 D B 0.0000 Buried
99 F B -0.3064 Soluble
100 A B 0.0000 Buried
101 T B -0.0428 Soluble
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 Q B 0.0000 Buried
106 Q B 0.0000 Buried
107 S B -0.0864 Soluble
108 S B -0.5111 Soluble
109 N B -1.3621 Soluble
114 T B -0.8153 Soluble
115 P B -1.0180 Soluble
116 F B 0.0000 Buried
117 T B -0.9980 Soluble
118 F B 0.0000 Buried
119 G B 0.0000 Buried
120 P B -0.7556 Soluble
121 G B -0.2893 Soluble
122 T B 0.0000 Buried
123 V B 0.4139 Aggregation-prone
124 V B 0.0000 Buried
125 D B -1.0004 Soluble
126 F B 0.3275 Aggregation-prone
127 R B -1.2486 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.399 2.6727 CSV PDB
4.5 -0.437 2.6727 CSV PDB
5.0 -0.4797 2.6727 CSV PDB
5.5 -0.5209 2.6727 CSV PDB
6.0 -0.5548 2.6727 CSV PDB
6.5 -0.5771 2.6727 CSV PDB
7.0 -0.5888 2.6727 CSV PDB
7.5 -0.5939 2.6727 CSV PDB
8.0 -0.5949 2.6727 CSV PDB
8.5 -0.5912 2.6727 CSV PDB
9.0 -0.5805 2.6727 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH