Teropavimab / 8c8t

A4DAB261_8c8t_R_T | Source PDB: 8c8t | Chains: R, T | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.7641
Max Score
1.4283
Min Score
-2.9851
Total Score
-164.28
Score CDR
-0.7262
Score non-CDR
-0.7725

Calculation Parameters

Chain Sequence(s) VQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTFSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVDIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKLERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTR input.pdb
Selected Chain(s) R (Heavy), T (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.9851
Maximum Score 1.4283
Average Score -0.7641
Total Score -164.2807

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V R 0.9234 Aggregation-prone
3 Q R -0.3107 Soluble
4 L R 0.0000 Buried
5 L R 0.1355 Aggregation-prone
6 Q R -0.1690 Soluble
7 S R -0.7300 Soluble
8 G R -0.7830 Soluble
9 A R -0.2388 Soluble
11 A R 0.3162 Aggregation-prone
12 V R 1.4283 Aggregation-prone
13 T R 0.1287 Aggregation-prone
14 K R -1.5719 Soluble
15 P R -1.4622 Soluble
16 G R -1.6600 Soluble
17 A R -1.3922 Soluble
18 S R -1.7624 Soluble
19 V R 0.0000 Buried
20 R R -2.3601 Soluble
21 V R 0.0000 Buried
22 S R -0.7206 Soluble
23 C R 0.0000 Buried
24 E R -0.8886 Soluble
25 A R 0.0000 Buried
26 S R -0.7119 Soluble
27 G R -0.4903 Soluble
28 Y R -0.9135 Soluble
29 N R -1.9557 Soluble
30 I R 0.0000 Buried
35 R R -2.8016 Soluble
36 D R -2.7721 Soluble
37 Y R -1.1433 Soluble
38 F R -0.0760 Soluble
39 I R 0.0000 Buried
40 H R 0.0000 Buried
41 W R 0.0000 Buried
42 W R 0.0000 Buried
43 R R -0.4986 Soluble
44 Q R -0.9254 Soluble
45 A R -1.0536 Soluble
46 P R -0.8527 Soluble
47 G R -1.2629 Soluble
48 Q R -1.7378 Soluble
49 G R -0.9109 Soluble
50 L R 0.0000 Buried
51 Q R -0.7253 Soluble
52 W R -0.1012 Soluble
53 V R 0.0000 Buried
54 G R 0.0000 Buried
55 W R -0.1573 Soluble
56 I R 0.0000 Buried
57 N R -1.4270 Soluble
58 P R 0.0000 Buried
59 K R -2.6085 Soluble
62 T R -1.5663 Soluble
63 G R -1.5798 Soluble
64 Q R -1.8350 Soluble
65 P R -1.2048 Soluble
66 N R -1.5316 Soluble
67 N R -1.4967 Soluble
68 P R -1.8340 Soluble
69 R R -2.9851 Soluble
70 Q R -2.4634 Soluble
71 F R -1.9211 Soluble
72 Q R -2.5188 Soluble
74 G R -1.7978 Soluble
75 R R -1.6294 Soluble
76 V R -1.4233 Soluble
77 S R -1.2283 Soluble
78 L R 0.0000 Buried
79 T R -0.8432 Soluble
80 R R -1.3675 Soluble
81 H R -1.1595 Soluble
82 A R -0.9561 Soluble
83 S R -0.1908 Soluble
84 W R 0.3312 Aggregation-prone
85 D R -1.1496 Soluble
85A F R -0.4705 Soluble
85B D R -1.8615 Soluble
85C T R -1.1363 Soluble
85D F R 0.0000 Buried
86 S R -0.7086 Soluble
87 F R 0.0000 Buried
88 Y R -0.8332 Soluble
89 M R 0.0000 Buried
90 D R -1.9406 Soluble
91 L R 0.0000 Buried
92 K R -2.5606 Soluble
93 A R -1.8717 Soluble
94 L R 0.0000 Buried
95 R R -2.8996 Soluble
96 S R -2.0813 Soluble
97 D R -2.3357 Soluble
98 D R 0.0000 Buried
99 T R -0.7423 Soluble
100 A R 0.0000 Buried
101 V R -0.1876 Soluble
102 Y R 0.0000 Buried
103 F R 0.0000 Buried
104 C R 0.0000 Buried
105 A R 0.0000 Buried
106 R R 0.0000 Buried
107 Q R -0.2614 Soluble
108 R R -0.8191 Soluble
109 S R -0.8664 Soluble
110 D R -1.5435 Soluble
112 Y R -0.2879 Soluble
113 W R -0.2811 Soluble
114 D R 0.0000 Buried
115 F R 0.0000 Buried
116 D R -0.6147 Soluble
117 V R -0.0190 Soluble
118 W R -0.1501 Soluble
119 G R 0.0000 Buried
120 S R -0.4245 Soluble
121 G R -0.7046 Soluble
122 T R 0.0000 Buried
123 Q R -0.8974 Soluble
124 V R 0.0000 Buried
125 T R 0.0274 Aggregation-prone
126 V R -0.0077 Soluble
1 D T -1.9247 Soluble
2 I T -1.0075 Soluble
3 Q T -1.5833 Soluble
4 M T -0.9329 Soluble
5 T T -0.6207 Soluble
6 Q T -0.5572 Soluble
7 S T -0.5537 Soluble
8 P T -0.4762 Soluble
9 S T -0.7300 Soluble
10 S T -0.7495 Soluble
11 L T -0.1395 Soluble
12 S T -0.0560 Soluble
13 A T 0.1866 Aggregation-prone
14 S T 0.0511 Aggregation-prone
15 V T 0.4684 Aggregation-prone
16 G T -1.1169 Soluble
17 D T -1.7959 Soluble
18 T T -1.1229 Soluble
19 V T -0.3535 Soluble
20 T T -0.1140 Soluble
21 I T 0.0000 Buried
22 T T -0.9310 Soluble
23 C T 0.0000 Buried
24 Q T -2.0456 Soluble
25 A T 0.0000 Buried
27 N T -2.1479 Soluble
28 G T -0.6658 Soluble
38 Y T 0.1749 Aggregation-prone
39 L T 0.0000 Buried
40 N T 0.0000 Buried
41 W T 0.0000 Buried
42 Y T 0.0000 Buried
43 Q T 0.0000 Buried
44 Q T -1.6826 Soluble
45 R T -2.6485 Soluble
46 R T -2.8337 Soluble
47 G T -2.4614 Soluble
48 K T -2.9516 Soluble
49 A T -1.5512 Soluble
50 P T 0.0000 Buried
51 K T -1.2201 Soluble
52 L T 0.0000 Buried
53 L T 0.0000 Buried
54 I T 0.0000 Buried
55 Y T -0.3200 Soluble
56 D T -0.5904 Soluble
57 G T 0.0000 Buried
65 S T -1.7724 Soluble
66 K T -2.0453 Soluble
67 L T -0.9211 Soluble
68 E T -1.3889 Soluble
69 R T -2.2074 Soluble
70 G T -1.3083 Soluble
71 V T -0.6759 Soluble
72 P T -0.6354 Soluble
74 S T -0.6746 Soluble
75 R T -0.8617 Soluble
76 F T 0.0000 Buried
77 S T -1.0919 Soluble
78 G T -1.6485 Soluble
79 R T -2.4866 Soluble
80 R T -1.7585 Soluble
83 W T -0.4280 Soluble
84 G T -1.0556 Soluble
85 Q T -2.1016 Soluble
86 E T -1.9459 Soluble
87 Y T 0.0000 Buried
88 N T -1.3346 Soluble
89 L T 0.0000 Buried
90 T T -0.6303 Soluble
91 I T 0.0000 Buried
92 N T -1.5965 Soluble
93 N T -2.0232 Soluble
94 L T 0.0000 Buried
95 Q T -1.3649 Soluble
96 P T -0.6598 Soluble
97 E T -1.6655 Soluble
98 D T 0.0000 Buried
99 I T 0.5335 Aggregation-prone
100 A T -0.6073 Soluble
101 T T -0.9916 Soluble
102 Y T 0.0000 Buried
103 F T 0.0000 Buried
104 C T 0.0000 Buried
105 Q T 0.0000 Buried
106 V T 0.0000 Buried
116 Y T 0.4269 Aggregation-prone
117 E T 0.2854 Aggregation-prone
118 F T 1.0341 Aggregation-prone
119 V T 0.6656 Aggregation-prone
120 V T 0.1618 Aggregation-prone
121 P T -0.9464 Soluble
122 G T -0.8489 Soluble
123 T T 0.0000 Buried
124 R T -1.6348 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6342 4.2086 CSV PDB
4.5 -0.6759 3.9768 CSV PDB
5.0 -0.7238 3.7029 CSV PDB
5.5 -0.7695 3.41 CSV PDB
6.0 -0.805 3.1102 CSV PDB
6.5 -0.8273 2.8085 CSV PDB
7.0 -0.8395 2.5073 CSV PDB
7.5 -0.8465 2.3702 CSV PDB
8.0 -0.85 2.3603 CSV PDB
8.5 -0.8486 2.3567 CSV PDB
9.0 -0.8389 2.3553 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH