Otilimab / 5c7x

A4DAB198_5c7x_M_N | Source PDB: 5c7x | Chains: M, N | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.6806
Max Score
1.8467
Min Score
-3.195
Total Score
-281.75
Score CDR
-0.621
Score non-CDR
-0.6875

Calculation Parameters

Chain Sequence(s) QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSGIENKYAGGATYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGFGTDFWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPDIELTQPPSVSVAPGQTARISCSGDSIGKKYAYWYQQKPGQAPVLVIYKKRERFSGSNSGNTATLTISGTQAEDEADYYCSAWGDKGMVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP input.pdb
Selected Chain(s) M (Heavy), N (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.195
Maximum Score 1.8467
Average Score -0.6806
Total Score -281.7487

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q M -1.4600 Soluble
2 V M -0.5760 Soluble
3 Q M -0.7509 Soluble
4 L M 0.0000 Buried
5 V M 1.1227 Aggregation-prone
6 E M 0.1342 Aggregation-prone
7 S M -0.4122 Soluble
8 G M -0.8021 Soluble
9 G M -0.6763 Soluble
11 G M -0.4043 Soluble
12 L M -0.1792 Soluble
13 V M 0.0000 Buried
14 Q M -1.6005 Soluble
15 P M -1.5920 Soluble
16 G M -1.3715 Soluble
17 G M 0.0000 Buried
18 S M -1.2166 Soluble
19 L M -1.0323 Soluble
20 R M -1.7442 Soluble
21 L M 0.0000 Buried
22 S M -0.3527 Soluble
23 C M 0.0000 Buried
24 A M -0.1591 Soluble
25 A M 0.0000 Buried
26 S M -0.8571 Soluble
27 G M -0.9625 Soluble
28 F M -0.2980 Soluble
29 T M -0.1563 Soluble
30 F M 0.0000 Buried
35 S M -1.0698 Soluble
36 S M -0.2951 Soluble
37 Y M 0.3678 Aggregation-prone
38 W M 0.3078 Aggregation-prone
39 M M 0.0000 Buried
40 N M 0.0000 Buried
41 W M 0.0000 Buried
42 V M 0.0000 Buried
43 R M 0.0000 Buried
44 Q M -0.7380 Soluble
45 A M -1.1694 Soluble
46 P M -0.9849 Soluble
47 G M -1.4670 Soluble
48 K M -2.2626 Soluble
49 G M -1.4529 Soluble
50 L M 0.0000 Buried
51 E M -1.0322 Soluble
52 W M 0.0000 Buried
53 V M 0.0000 Buried
54 S M 0.0000 Buried
55 G M 0.0000 Buried
56 I M 0.0000 Buried
57 E M -0.3659 Soluble
58 N M -0.9158 Soluble
59 K M -1.4640 Soluble
60 Y M 0.2340 Aggregation-prone
61 A M -0.1968 Soluble
62 G M -0.7412 Soluble
63 G M -0.6971 Soluble
64 A M -0.2992 Soluble
65 T M 0.3239 Aggregation-prone
66 Y M 0.5327 Aggregation-prone
67 Y M -0.3065 Soluble
68 A M 0.0000 Buried
69 A M -0.8224 Soluble
70 S M -0.9356 Soluble
71 V M 0.0000 Buried
72 K M -1.8290 Soluble
74 G M -1.5473 Soluble
75 R M -1.5152 Soluble
76 F M 0.0000 Buried
77 T M -0.7213 Soluble
78 I M 0.0000 Buried
79 S M -0.5334 Soluble
80 R M -1.5078 Soluble
81 D M -2.1352 Soluble
82 N M -2.2588 Soluble
83 S M -1.8061 Soluble
84 K M -2.6443 Soluble
85 N M -2.0259 Soluble
86 T M -1.2237 Soluble
87 L M 0.0000 Buried
88 Y M -0.6255 Soluble
89 L M 0.0000 Buried
90 Q M -1.1371 Soluble
91 M M 0.0000 Buried
92 N M -1.5036 Soluble
93 S M -1.2696 Soluble
94 L M 0.0000 Buried
95 R M -2.0706 Soluble
96 A M -1.5977 Soluble
97 E M -2.1400 Soluble
98 D M 0.0000 Buried
99 T M -0.7199 Soluble
100 A M 0.0000 Buried
101 V M 0.1912 Aggregation-prone
102 Y M 0.0000 Buried
103 Y M 0.0000 Buried
104 C M 0.0000 Buried
105 A M 0.0000 Buried
106 R M 0.0000 Buried
107 G M 0.0000 Buried
108 F M 1.8467 Aggregation-prone
114 G M 0.7942 Aggregation-prone
115 T M 0.0000 Buried
116 D M 0.8486 Aggregation-prone
117 F M 0.9699 Aggregation-prone
118 W M 0.4796 Aggregation-prone
119 G M 0.0000 Buried
120 Q M -1.1943 Soluble
121 G M -0.5784 Soluble
122 T M -0.1232 Soluble
123 L M 0.0698 Aggregation-prone
124 V M 0.0000 Buried
125 T M -0.4288 Soluble
126 V M 0.0000 Buried
127 S M -0.9227 Soluble
128 S M -0.7339 Soluble
129 A M -0.4657 Soluble
130 S M -0.6261 Soluble
131 T M -0.5918 Soluble
132 K M -1.0702 Soluble
133 G M -1.3532 Soluble
134 P M -0.4238 Soluble
135 S M -0.1278 Soluble
136 V M -0.2854 Soluble
137 F M -0.1497 Soluble
138 P M -0.6443 Soluble
139 L M 0.0000 Buried
140 A M -0.7621 Soluble
141 P M -0.5346 Soluble
142 S M -0.3796 Soluble
143 S M -0.4879 Soluble
144 G M -0.7733 Soluble
145 G M -0.7657 Soluble
146 T M -0.5507 Soluble
147 A M 0.0000 Buried
148 A M 0.0000 Buried
149 L M 0.0000 Buried
150 G M 0.0000 Buried
151 C M 0.0000 Buried
152 L M 0.0000 Buried
153 V M 0.0000 Buried
154 K M 0.0000 Buried
155 D M -0.1235 Soluble
156 Y M 0.0000 Buried
157 F M -0.1311 Soluble
158 P M 0.0000 Buried
159 E M -0.4205 Soluble
160 P M -0.6719 Soluble
161 V M -0.6174 Soluble
162 T M -0.4791 Soluble
163 V M -0.2343 Soluble
164 S M -0.3197 Soluble
165 W M 0.0000 Buried
166 N M -0.6584 Soluble
167 S M -0.6315 Soluble
168 G M -0.5124 Soluble
169 A M -0.2482 Soluble
170 L M 0.0168 Aggregation-prone
171 T M -0.1783 Soluble
172 S M -0.2354 Soluble
173 G M -0.2799 Soluble
174 V M 0.2470 Aggregation-prone
175 H M -0.0645 Soluble
176 T M -0.0054 Soluble
177 F M 0.0000 Buried
178 P M -0.1845 Soluble
179 A M 0.2164 Aggregation-prone
180 V M 0.0000 Buried
181 L M 1.0399 Aggregation-prone
182 Q M 0.2187 Aggregation-prone
183 S M -0.1634 Soluble
184 S M -0.1388 Soluble
185 G M 0.1972 Aggregation-prone
186 L M 0.3349 Aggregation-prone
187 Y M 0.5002 Aggregation-prone
188 S M 0.0000 Buried
189 L M 0.0000 Buried
190 S M 0.0000 Buried
191 S M 0.0000 Buried
192 V M 0.0000 Buried
193 V M 0.0000 Buried
194 T M -0.2569 Soluble
195 V M 0.0000 Buried
196 P M -0.5021 Soluble
197 S M -0.6026 Soluble
198 S M -0.6569 Soluble
199 S M -0.6775 Soluble
200 L M -0.8259 Soluble
201 G M -0.9985 Soluble
202 T M -0.8336 Soluble
203 Q M -1.2842 Soluble
204 T M -1.0849 Soluble
205 Y M 0.0000 Buried
206 I M -0.9075 Soluble
207 C M 0.0000 Buried
208 N M -1.2109 Soluble
209 V M 0.0000 Buried
210 N M -1.7298 Soluble
211 H M 0.0000 Buried
212 K M -2.7335 Soluble
213 P M -1.5702 Soluble
214 S M -1.7683 Soluble
215 N M -2.4345 Soluble
216 T M -1.9991 Soluble
217 K M -2.5033 Soluble
218 V M -1.2269 Soluble
219 D M -2.1317 Soluble
220 K M -1.8292 Soluble
221 K M -2.0925 Soluble
222 V M 0.0000 Buried
223 E M -2.2772 Soluble
224 P M -1.1911 Soluble
1 D N -3.0595 Soluble
2 I N -2.4561 Soluble
3 E N -2.5340 Soluble
4 L N 0.0000 Buried
5 T N -0.9046 Soluble
6 Q N 0.0000 Buried
7 P N -0.5099 Soluble
8 P N -0.8228 Soluble
9 S N -0.7742 Soluble
11 V N -0.6268 Soluble
12 S N -0.2349 Soluble
13 V N 0.0000 Buried
14 A N -0.4428 Soluble
15 P N -1.1371 Soluble
16 G N -1.4473 Soluble
17 Q N -1.6685 Soluble
18 T N -1.4518 Soluble
19 A N 0.0000 Buried
20 R N -1.8874 Soluble
21 I N 0.0000 Buried
22 S N -0.7275 Soluble
23 C N 0.0000 Buried
24 S N -1.2388 Soluble
25 G N -1.9460 Soluble
26 D N -2.9481 Soluble
27 S N -2.0697 Soluble
28 I N 0.0000 Buried
29 G N -2.2091 Soluble
36 K N -2.5530 Soluble
37 K N -1.4685 Soluble
38 Y N -0.5617 Soluble
39 A N 0.0000 Buried
40 Y N 0.0000 Buried
41 W N 0.0000 Buried
42 Y N 0.0000 Buried
43 Q N 0.0000 Buried
44 Q N -0.9270 Soluble
45 K N -1.7082 Soluble
46 P N -1.4382 Soluble
47 G N -1.6050 Soluble
48 Q N -1.9127 Soluble
49 A N 0.0000 Buried
50 P N 0.0000 Buried
51 V N 1.0237 Aggregation-prone
52 L N 0.0000 Buried
53 V N 0.6114 Aggregation-prone
54 I N 0.0000 Buried
55 Y N -0.2859 Soluble
56 K N -2.2908 Soluble
65 K N -3.0469 Soluble
73 R N -2.8590 Soluble
74 E N -2.1720 Soluble
75 R N -1.7013 Soluble
76 F N -0.6256 Soluble
77 S N -0.7924 Soluble
78 G N -0.4453 Soluble
79 S N -0.6574 Soluble
80 N N -1.3330 Soluble
83 S N -1.3913 Soluble
84 G N -1.9258 Soluble
85 N N -2.2405 Soluble
86 T N -1.1996 Soluble
87 A N 0.0000 Buried
88 T N -0.8404 Soluble
89 L N 0.0000 Buried
90 T N -1.0080 Soluble
91 I N 0.0000 Buried
92 S N -1.4626 Soluble
93 G N -1.1805 Soluble
94 T N 0.0000 Buried
95 Q N -1.5701 Soluble
96 A N -1.3829 Soluble
97 E N -2.3626 Soluble
98 D N 0.0000 Buried
99 E N 0.0000 Buried
100 A N 0.0000 Buried
101 D N -1.3474 Soluble
102 Y N 0.0000 Buried
103 Y N 0.0000 Buried
104 C N 0.0000 Buried
105 S N 0.0000 Buried
106 A N 0.0000 Buried
107 W N -0.4665 Soluble
108 G N -2.1072 Soluble
109 D N -3.0129 Soluble
114 K N -2.6664 Soluble
115 G N -1.4115 Soluble
116 M N 0.0000 Buried
117 V N -1.0686 Soluble
118 F N 0.0000 Buried
119 G N -0.7338 Soluble
120 G N -1.2768 Soluble
121 G N 0.0000 Buried
122 T N 0.0000 Buried
123 K N -1.5527 Soluble
124 L N 0.0000 Buried
125 T N -0.1566 Soluble
126 V N 0.0000 Buried
127 L N 0.7242 Aggregation-prone
128 G N -0.4496 Soluble
129 Q N -0.8929 Soluble
130 P N -1.1710 Soluble
131 K N -2.1604 Soluble
132 A N -1.2581 Soluble
133 A N -0.6627 Soluble
134 P N 0.0000 Buried
135 S N -0.5937 Soluble
136 V N 0.0000 Buried
137 T N -0.5685 Soluble
138 L N 0.0000 Buried
139 F N 0.0000 Buried
140 P N -0.1391 Soluble
141 P N 0.0000 Buried
142 S N -0.5615 Soluble
143 S N -1.0484 Soluble
144 E N -1.4216 Soluble
145 E N 0.0000 Buried
146 L N -1.6135 Soluble
147 Q N -1.9708 Soluble
148 A N -1.5856 Soluble
149 N N -2.3928 Soluble
150 K N -2.1621 Soluble
151 A N 0.0000 Buried
152 T N 0.0000 Buried
153 L N 0.0000 Buried
154 V N 0.0000 Buried
155 C N 0.0000 Buried
156 L N 0.0000 Buried
157 I N 0.0000 Buried
158 S N -0.5128 Soluble
159 D N -0.9583 Soluble
160 F N 0.0000 Buried
161 Y N -1.0180 Soluble
162 P N -0.8710 Soluble
163 G N -0.3912 Soluble
164 A N -0.1818 Soluble
165 V N -0.1324 Soluble
166 T N -0.0823 Soluble
167 V N -0.0461 Soluble
168 A N -0.5259 Soluble
169 W N 0.0000 Buried
170 K N -1.0775 Soluble
171 A N 0.0000 Buried
172 D N -1.3087 Soluble
173 S N -0.8697 Soluble
174 S N -0.6507 Soluble
175 P N -0.9731 Soluble
176 V N -0.9637 Soluble
177 K N -1.7320 Soluble
178 A N -0.8238 Soluble
179 G N -0.6534 Soluble
180 V N -0.5288 Soluble
181 E N -0.4969 Soluble
182 T N -0.0799 Soluble
183 T N 0.0000 Buried
184 T N -0.1675 Soluble
185 P N -0.2447 Soluble
186 S N -0.4215 Soluble
187 K N -0.9846 Soluble
188 Q N -1.0701 Soluble
189 S N -1.4278 Soluble
190 N N -1.8275 Soluble
191 N N 0.0000 Buried
192 K N -1.2590 Soluble
193 Y N -0.5915 Soluble
194 A N 0.0000 Buried
195 A N 0.0000 Buried
196 S N 0.0000 Buried
197 S N 0.0000 Buried
198 Y N 0.0000 Buried
199 L N 0.0000 Buried
200 S N -0.4181 Soluble
201 L N -0.9917 Soluble
202 T N -1.7347 Soluble
203 P N -2.3867 Soluble
204 E N -3.1745 Soluble
205 Q N -2.4520 Soluble
206 W N 0.0000 Buried
207 K N -3.1950 Soluble
208 S N -2.5022 Soluble
209 H N -2.4061 Soluble
210 R N -2.5350 Soluble
211 S N -1.5366 Soluble
212 Y N 0.0000 Buried
213 S N -1.0633 Soluble
214 C N 0.0000 Buried
215 Q N -1.0162 Soluble
216 V N 0.0000 Buried
217 T N -0.6595 Soluble
218 H N 0.0000 Buried
219 E N -2.2711 Soluble
220 G N -1.4307 Soluble
221 S N -0.8398 Soluble
222 T N -0.6504 Soluble
223 V N -0.5618 Soluble
224 E N -2.1323 Soluble
225 K N -1.9475 Soluble
226 T N -1.0935 Soluble
227 V N -0.4079 Soluble
228 A N -0.9129 Soluble
229 P N -1.1803 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6035 4.3792 CSV PDB
4.5 -0.6391 4.3573 CSV PDB
5.0 -0.6791 4.333 CSV PDB
5.5 -0.7142 4.3079 CSV PDB
6.0 -0.7335 4.2836 CSV PDB
6.5 -0.7283 4.2617 CSV PDB
7.0 -0.7001 4.2433 CSV PDB
7.5 -0.6577 4.2281 CSV PDB
8.0 -0.608 4.2167 CSV PDB
8.5 -0.5534 4.2097 CSV PDB
9.0 -0.4944 4.2064 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH