Maftivimab / 7tn9

A4DAB164_7tn9_Q_R | Source PDB: 7tn9 | Chains: Q, R | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5375
Max Score
1.4162
Min Score
-2.7477
Total Score
-118.78
Score CDR
-0.1491
Score non-CDR
-0.634

Calculation Parameters

Chain Sequence(s) EVQLVESGGGLVQPGGSLRLSCAASGFTSSSYAMNWVRQAPGKGLEWVSTISGMGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKRGYPHSFDIWGQGTMVTVDIQMTQSPSSLSASVGDRVTITCRASQSISSFLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTLTFGQGTRLEI input.pdb
Selected Chain(s) Q (Heavy), R (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.7477
Maximum Score 1.4162
Average Score -0.5375
Total Score -118.7817

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E Q -1.9339 Soluble
2 V Q -0.8602 Soluble
3 Q Q -1.4123 Soluble
4 L Q 0.0000 Buried
5 V Q -0.1568 Soluble
6 E Q 0.0000 Buried
7 S Q -0.6900 Soluble
8 G Q -0.7985 Soluble
9 G Q -0.2754 Soluble
11 G Q 0.4265 Aggregation-prone
12 L Q 1.4162 Aggregation-prone
13 V Q 0.3787 Aggregation-prone
14 Q Q -1.0904 Soluble
15 P Q -1.4603 Soluble
16 G Q -1.5493 Soluble
17 G Q -0.9774 Soluble
18 S Q -1.1732 Soluble
19 L Q -0.8510 Soluble
20 R Q -1.7192 Soluble
21 L Q 0.0000 Buried
22 S Q -0.5225 Soluble
23 C Q 0.0000 Buried
24 A Q -0.4336 Soluble
25 A Q 0.0000 Buried
26 S Q -0.9975 Soluble
27 G Q -1.0251 Soluble
28 F Q -0.3306 Soluble
29 T Q -0.3553 Soluble
30 S Q 0.0000 Buried
35 S Q -0.2867 Soluble
36 S Q 0.2225 Aggregation-prone
37 Y Q 0.2580 Aggregation-prone
38 A Q -0.2581 Soluble
39 M Q 0.0000 Buried
40 N Q 0.0000 Buried
41 W Q 0.0000 Buried
42 V Q 0.0000 Buried
43 R Q 0.0000 Buried
44 Q Q 0.0000 Buried
45 A Q -1.0781 Soluble
46 P Q -0.9651 Soluble
47 G Q -1.4569 Soluble
48 K Q -2.3279 Soluble
49 G Q -1.5068 Soluble
50 L Q 0.0000 Buried
51 E Q -1.0827 Soluble
52 W Q 0.0000 Buried
53 V Q 0.0000 Buried
54 S Q 0.0000 Buried
55 T Q 0.0000 Buried
56 I Q 0.0000 Buried
57 S Q 0.0963 Aggregation-prone
58 G Q 0.1191 Aggregation-prone
59 M Q 0.6571 Aggregation-prone
62 G Q -0.1238 Soluble
63 G Q -0.1975 Soluble
64 S Q 0.1005 Aggregation-prone
65 T Q 0.3985 Aggregation-prone
66 Y Q 0.8601 Aggregation-prone
67 Y Q -0.3123 Soluble
68 A Q 0.0000 Buried
69 D Q -2.3274 Soluble
70 S Q -1.7272 Soluble
71 V Q 0.0000 Buried
72 K Q -2.4472 Soluble
74 G Q -1.7767 Soluble
75 R Q -1.5515 Soluble
76 F Q 0.0000 Buried
77 T Q -0.5941 Soluble
78 I Q 0.0000 Buried
79 S Q -0.3502 Soluble
80 R Q -0.6803 Soluble
81 D Q -1.1589 Soluble
82 N Q -1.3941 Soluble
83 S Q -1.5300 Soluble
84 K Q -2.2366 Soluble
85 N Q -1.5135 Soluble
86 T Q -0.9615 Soluble
87 L Q 0.0000 Buried
88 Y Q -0.3262 Soluble
89 L Q 0.0000 Buried
90 Q Q -0.9885 Soluble
91 M Q 0.0000 Buried
92 N Q -1.4192 Soluble
93 S Q -1.4654 Soluble
94 L Q 0.0000 Buried
95 R Q -2.6277 Soluble
96 A Q -1.6475 Soluble
97 E Q -1.8233 Soluble
98 D Q 0.0000 Buried
99 T Q -0.2598 Soluble
100 A Q 0.0000 Buried
101 V Q 0.2066 Aggregation-prone
102 Y Q 0.0000 Buried
103 Y Q 0.0000 Buried
104 C Q 0.0000 Buried
105 A Q 0.0000 Buried
106 K Q -0.8720 Soluble
107 R Q -1.5869 Soluble
108 G Q -0.3532 Soluble
109 Y Q 0.9097 Aggregation-prone
110 P Q 0.0000 Buried
113 H Q -0.3472 Soluble
114 S Q 0.0000 Buried
115 F Q 0.0000 Buried
116 D Q -0.7724 Soluble
117 I Q -0.4280 Soluble
118 W Q -0.7910 Soluble
119 G Q 0.0000 Buried
120 Q Q -1.5641 Soluble
121 G Q -0.8397 Soluble
122 T Q -0.2177 Soluble
123 M Q 0.4550 Aggregation-prone
124 V Q 0.0000 Buried
125 T Q 0.6234 Aggregation-prone
126 V Q 0.0116 Aggregation-prone
1 D R -2.3250 Soluble
2 I R 0.0000 Buried
3 Q R -2.3448 Soluble
4 M R 0.0000 Buried
5 T R -1.4556 Soluble
6 Q R 0.0000 Buried
7 S R -0.7962 Soluble
8 P R -0.4884 Soluble
9 S R -0.8597 Soluble
10 S R -1.0965 Soluble
11 L R -0.6104 Soluble
12 S R -0.4722 Soluble
13 A R -0.0528 Soluble
14 S R 0.1226 Aggregation-prone
15 V R 0.2356 Aggregation-prone
16 G R -0.8412 Soluble
17 D R -1.4890 Soluble
18 R R -2.1876 Soluble
19 V R 0.0000 Buried
20 T R -0.4801 Soluble
21 I R 0.0000 Buried
22 T R -0.8085 Soluble
23 C R 0.0000 Buried
24 R R -2.7477 Soluble
25 A R 0.0000 Buried
26 S R -2.1035 Soluble
27 Q R -2.2636 Soluble
28 S R -1.2275 Soluble
29 I R 0.0000 Buried
36 S R -0.2147 Soluble
37 S R -0.1084 Soluble
38 F R 0.8427 Aggregation-prone
39 L R 0.0000 Buried
40 N R 0.0000 Buried
41 W R 0.0000 Buried
42 Y R 0.0000 Buried
43 Q R 0.0000 Buried
44 Q R 0.0000 Buried
45 K R -1.8702 Soluble
46 P R -1.4766 Soluble
47 G R -1.6786 Soluble
48 K R -2.6007 Soluble
49 A R -1.6773 Soluble
50 P R 0.0000 Buried
51 K R -1.5962 Soluble
52 L R 0.0000 Buried
53 L R 0.0000 Buried
54 I R 0.0000 Buried
55 Y R 0.5184 Aggregation-prone
56 A R 0.4112 Aggregation-prone
57 A R 0.0000 Buried
65 S R -0.2720 Soluble
66 S R -0.0625 Soluble
67 L R 0.1206 Aggregation-prone
68 Q R -0.4407 Soluble
69 S R -0.4552 Soluble
70 G R -0.5278 Soluble
71 V R -0.3877 Soluble
72 P R -0.3678 Soluble
74 S R -0.4984 Soluble
75 R R -0.8712 Soluble
76 F R 0.0000 Buried
77 S R -0.3621 Soluble
78 G R -0.3306 Soluble
79 S R -0.7149 Soluble
80 G R -0.7792 Soluble
83 S R -0.9791 Soluble
84 G R -1.0597 Soluble
85 T R -1.6775 Soluble
86 D R -2.0798 Soluble
87 F R 0.0000 Buried
88 T R -0.7504 Soluble
89 L R 0.0000 Buried
90 T R -0.6646 Soluble
91 I R 0.0000 Buried
92 S R -1.4162 Soluble
93 S R -1.2445 Soluble
94 L R 0.0000 Buried
95 Q R -1.3067 Soluble
96 P R -1.1118 Soluble
97 E R -1.9185 Soluble
98 D R 0.0000 Buried
99 F R -1.1303 Soluble
100 A R 0.0000 Buried
101 T R 0.0000 Buried
102 Y R 0.0000 Buried
103 Y R 0.0000 Buried
104 C R 0.0000 Buried
105 Q R 0.0000 Buried
106 Q R 0.0000 Buried
107 S R 0.6269 Aggregation-prone
108 Y R 0.7685 Aggregation-prone
114 S R 0.0174 Aggregation-prone
115 T R -0.3349 Soluble
116 L R 0.0000 Buried
117 T R -0.6327 Soluble
118 F R -0.4910 Soluble
119 G R 0.0000 Buried
120 Q R -1.7204 Soluble
121 G R 0.0000 Buried
122 T R 0.0000 Buried
123 R R -2.3790 Soluble
124 L R 0.0000 Buried
125 E R -1.2064 Soluble
126 I R 1.2486 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6699 2.4672 CSV PDB
4.5 -0.6992 2.3254 CSV PDB
5.0 -0.7324 2.2306 CSV PDB
5.5 -0.7633 2.2306 CSV PDB
6.0 -0.7854 2.2306 CSV PDB
6.5 -0.7942 2.2306 CSV PDB
7.0 -0.7909 2.2306 CSV PDB
7.5 -0.7799 2.2306 CSV PDB
8.0 -0.7647 2.2306 CSV PDB
8.5 -0.7457 2.2306 CSV PDB
9.0 -0.7232 2.2306 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH