Bimagrumab / 5nhr

A4DAB047_5nhr_H_L | Source PDB: 5nhr | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5121
Max Score
1.849
Min Score
-3.4771
Total Score
-115.74
Score CDR
-0.0408
Score non-CDR
-0.6359

Calculation Parameters

Chain Sequence(s) QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSYINWVRQAPGQGLEWMGTINPVSGSTSYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGWFDYWGQGTLVTVSSSALTQPASVSGSPGQSITISCTGTSSDVGSYNYVNWYQQHPGKAPKLMIYGVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCGTFAGGSYYGVFGGGTKLTVLW input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.4771
Maximum Score 1.849
Average Score -0.5121
Total Score -115.7428

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q H -1.5024 Soluble
2 V H -0.9132 Soluble
3 Q H -1.2357 Soluble
4 L H 0.0000 Buried
5 V H -0.0472 Soluble
6 Q H -0.4187 Soluble
7 S H -0.5762 Soluble
8 G H -0.5126 Soluble
9 A H 0.2275 Aggregation-prone
11 E H 0.1301 Aggregation-prone
12 V H 0.9971 Aggregation-prone
13 K H -0.9243 Soluble
14 K H -2.3569 Soluble
15 P H -2.3477 Soluble
16 G H -2.3478 Soluble
17 A H -1.7830 Soluble
18 S H -1.8355 Soluble
19 V H 0.0000 Buried
20 K H -1.7961 Soluble
21 V H 0.0000 Buried
22 S H -0.6485 Soluble
23 C H 0.0000 Buried
24 K H -0.8277 Soluble
25 A H 0.0000 Buried
26 S H -0.7164 Soluble
27 G H -1.0758 Soluble
28 Y H -0.4468 Soluble
29 T H -0.1480 Soluble
30 F H 0.0000 Buried
35 T H 0.2862 Aggregation-prone
36 S H 0.0401 Aggregation-prone
37 S H 0.0862 Aggregation-prone
38 Y H 0.1603 Aggregation-prone
39 I H 0.0000 Buried
40 N H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H -0.3246 Soluble
44 Q H -0.5838 Soluble
45 A H -0.9757 Soluble
46 P H -1.0046 Soluble
47 G H -1.3075 Soluble
48 Q H -1.7510 Soluble
49 G H -1.2310 Soluble
50 L H 0.0000 Buried
51 E H -0.7800 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 T H 0.0000 Buried
56 I H 0.0000 Buried
57 N H -0.0698 Soluble
58 P H 0.0000 Buried
59 V H 1.3869 Aggregation-prone
62 S H 0.4248 Aggregation-prone
63 G H -0.0808 Soluble
64 S H -0.2140 Soluble
65 T H -0.2721 Soluble
66 S H -0.1119 Soluble
67 Y H -0.5948 Soluble
68 A H 0.0000 Buried
69 Q H -2.5036 Soluble
70 K H -2.7403 Soluble
71 F H 0.0000 Buried
72 Q H -2.4511 Soluble
74 G H -1.6400 Soluble
75 R H -1.6832 Soluble
76 V H 0.0000 Buried
77 T H -0.8345 Soluble
78 M H 0.0000 Buried
79 T H -0.6755 Soluble
80 R H -0.8346 Soluble
81 D H -1.1686 Soluble
82 T H -0.1983 Soluble
83 S H -0.0934 Soluble
84 I H 0.4407 Aggregation-prone
85 S H -0.2459 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.8148 Soluble
89 M H 0.0000 Buried
90 E H -1.5201 Soluble
91 L H 0.0000 Buried
92 S H -1.9035 Soluble
93 R H -2.7867 Soluble
94 L H 0.0000 Buried
95 R H -3.4771 Soluble
96 S H -2.4271 Soluble
97 D H -2.4945 Soluble
98 D H 0.0000 Buried
99 T H -0.8232 Soluble
100 A H 0.0000 Buried
101 V H 0.3067 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H -0.1211 Soluble
107 G H 0.0000 Buried
108 G H 0.0000 Buried
114 W H 0.4090 Aggregation-prone
115 F H 0.0000 Buried
116 D H -0.2854 Soluble
117 Y H -0.0361 Soluble
118 W H -0.4822 Soluble
119 G H 0.0000 Buried
120 Q H -1.3144 Soluble
121 G H -0.6152 Soluble
122 T H 0.0000 Buried
123 L H 0.8256 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.1284 Soluble
126 V H 0.0000 Buried
127 S H -1.2962 Soluble
128 S H -1.0882 Soluble
2 S L -0.2370 Soluble
3 A L -0.1104 Soluble
4 L L 0.0000 Buried
5 T L -0.2729 Soluble
6 Q L 0.0000 Buried
7 P L -0.4071 Soluble
8 A L -0.5323 Soluble
9 S L -0.7083 Soluble
11 V L -0.1995 Soluble
12 S L -0.1331 Soluble
13 G L 0.0000 Buried
14 S L -0.0504 Soluble
15 P L -0.3593 Soluble
16 G L -1.3444 Soluble
17 Q L -1.6910 Soluble
18 S L -1.1192 Soluble
19 I L 0.0000 Buried
20 T L -0.1344 Soluble
21 I L 0.0000 Buried
22 S L -0.2430 Soluble
23 C L 0.0000 Buried
24 T L -0.4600 Soluble
25 G L -0.5243 Soluble
26 T L -0.6571 Soluble
27 S L -0.7502 Soluble
28 S L -0.5965 Soluble
29 D L -0.6379 Soluble
30 V L 0.0000 Buried
31 G L -0.9958 Soluble
35 S L -0.5610 Soluble
36 Y L -0.1458 Soluble
37 N L -0.9359 Soluble
38 Y L -0.0841 Soluble
39 V L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 H L -1.9270 Soluble
46 P L -1.4118 Soluble
47 G L -1.6618 Soluble
48 K L -2.5051 Soluble
49 A L -1.5606 Soluble
50 P L 0.0000 Buried
51 K L -1.5286 Soluble
52 L L 0.0000 Buried
53 M L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.7163 Soluble
56 G L -0.7520 Soluble
57 V L 0.0000 Buried
65 S L -1.4894 Soluble
66 K L -2.1182 Soluble
67 R L -1.8340 Soluble
68 P L -1.0902 Soluble
69 S L -0.8772 Soluble
70 G L -0.7694 Soluble
71 V L -0.8607 Soluble
72 S L -1.0174 Soluble
74 N L -1.6788 Soluble
75 R L -1.1054 Soluble
76 F L 0.0000 Buried
77 S L -1.0726 Soluble
78 G L -0.8493 Soluble
79 S L -0.9535 Soluble
80 K L -1.0773 Soluble
83 S L -0.8267 Soluble
84 G L -1.0178 Soluble
85 N L -1.0126 Soluble
86 T L -0.7338 Soluble
87 A L 0.0000 Buried
88 S L -0.3699 Soluble
89 L L 0.0000 Buried
90 T L -0.3155 Soluble
91 I L 0.0000 Buried
92 S L -1.1223 Soluble
93 G L -1.1382 Soluble
94 L L 0.0000 Buried
95 Q L -1.3284 Soluble
96 A L -0.9078 Soluble
97 E L -2.3297 Soluble
98 D L 0.0000 Buried
99 E L -1.9301 Soluble
100 A L 0.0000 Buried
101 D L -1.5322 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 G L 0.0000 Buried
106 T L 0.5507 Aggregation-prone
107 F L 0.7312 Aggregation-prone
108 A L 0.0000 Buried
109 G L 0.0000 Buried
110 G L -0.2046 Soluble
113 S L 0.0832 Aggregation-prone
114 Y L 0.8946 Aggregation-prone
115 Y L 1.5174 Aggregation-prone
116 G L 0.8667 Aggregation-prone
117 V L 0.5481 Aggregation-prone
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 G L -0.9670 Soluble
121 G L -1.0177 Soluble
122 T L 0.0000 Buried
123 K L -1.9484 Soluble
124 L L 0.0000 Buried
125 T L -0.4562 Soluble
126 V L 0.0000 Buried
127 L L 1.8490 Aggregation-prone
128 W L 1.8468 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6126 4.4339 CSV PDB
4.5 -0.6315 4.4339 CSV PDB
5.0 -0.6525 4.4339 CSV PDB
5.5 -0.67 4.4339 CSV PDB
6.0 -0.6778 4.4339 CSV PDB
6.5 -0.6709 4.4339 CSV PDB
7.0 -0.6493 4.4339 CSV PDB
7.5 -0.6186 4.4339 CSV PDB
8.0 -0.5832 4.4339 CSV PDB
8.5 -0.5446 4.4339 CSV PDB
9.0 -0.5036 4.4339 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH