Elipovimab / 7uoj

A4DAB100_7uoj_d_e | Source PDB: 7uoj | Chains: d, e | Done
96.61
Yes
10 Å
Yes
Avg A4D Score
-0.6614
Max Score
3.0068
Min Score
-2.8365
Total Score
-156.75
Score CDR
-0.3922
Score non-CDR
-0.7568

Calculation Parameters

Chain Sequence(s) QMQLQESGPGLVKPSETLSLTCSVSGASISDSYWSWIRRSPGKGLEWIGYVHKSGDTNYSPSLKSRVNLSLDTSKNQVSLSLVAATAADSGKYYCARTLHGRRIYGIVAFNEWFTYFYMDVWGNGTQVTVSSADISVAPGETARISCGEKSLGSRAVQWYQHRAGQAPSLIIYNNQDRPSGIPERFSGSPDSPFGTTATLTITSVEAGDEADYYCHIWDSRVPTKWVFGGGTTLTVL input.pdb
Selected Chain(s) d (Heavy), e (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8365
Maximum Score 3.0068
Average Score -0.6614
Total Score -156.7495

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q d -1.4624 Soluble
2 M d -1.3996 Soluble
3 Q d -2.0744 Soluble
4 L d 0.0000 Buried
5 Q d -2.1006 Soluble
6 E d -1.5664 Soluble
7 S d -0.8465 Soluble
8 G d -0.6152 Soluble
9 P d -0.0804 Soluble
11 G d 0.1060 Aggregation-prone
12 L d 0.9129 Aggregation-prone
13 V d -0.4784 Soluble
14 K d -1.9249 Soluble
15 P d -1.3010 Soluble
16 S d -1.2352 Soluble
17 E d -1.9954 Soluble
18 T d -0.8671 Soluble
19 L d 0.0000 Buried
20 S d -0.2470 Soluble
21 L d 0.0000 Buried
22 T d -0.5103 Soluble
23 C d 0.0000 Buried
24 S d -1.5564 Soluble
25 V d 0.0000 Buried
26 S d -1.4282 Soluble
27 G d -1.2965 Soluble
28 A d -1.2398 Soluble
29 S d -1.1749 Soluble
30 I d -1.5228 Soluble
35 S d -1.8360 Soluble
36 D d -2.2395 Soluble
37 S d -1.4509 Soluble
38 Y d -1.0545 Soluble
39 W d 0.0000 Buried
40 S d 0.0000 Buried
41 W d 0.0000 Buried
42 I d 0.0000 Buried
43 R d 0.0000 Buried
44 R d -1.4543 Soluble
45 S d -1.2326 Soluble
46 P d -1.1949 Soluble
47 G d -1.4265 Soluble
48 K d -2.1871 Soluble
49 G d -1.3614 Soluble
50 L d 0.0000 Buried
51 E d -0.3921 Soluble
52 W d 0.0000 Buried
53 I d 0.0000 Buried
54 G d 0.0000 Buried
55 Y d 0.0000 Buried
56 V d 0.0000 Buried
57 H d -2.3257 Soluble
58 K d -2.8365 Soluble
59 S d -1.8890 Soluble
63 G d -2.1453 Soluble
64 D d -2.6853 Soluble
65 T d -1.8098 Soluble
66 N d -1.4999 Soluble
67 Y d -0.9005 Soluble
68 S d -0.5652 Soluble
69 P d -0.9078 Soluble
70 S d -0.8146 Soluble
71 L d -1.5769 Soluble
72 K d -2.5975 Soluble
74 S d -1.9091 Soluble
75 R d -2.1991 Soluble
76 V d 0.0000 Buried
77 N d -1.6585 Soluble
78 L d -0.8253 Soluble
79 S d -0.6770 Soluble
80 L d -0.7851 Soluble
81 D d -1.5363 Soluble
82 T d -1.3019 Soluble
83 S d -1.5791 Soluble
84 K d -2.6591 Soluble
85 N d -2.4508 Soluble
86 Q d -1.7873 Soluble
87 V d 0.0000 Buried
88 S d -0.4342 Soluble
89 L d 0.0000 Buried
90 S d -0.6634 Soluble
91 L d 0.0000 Buried
92 V d -0.1478 Soluble
93 A d -0.6867 Soluble
94 A d 0.0000 Buried
95 T d -0.4274 Soluble
96 A d -0.2660 Soluble
97 A d -0.0134 Soluble
98 D d 0.0000 Buried
99 S d -0.3428 Soluble
100 G d -0.9473 Soluble
101 K d -1.3578 Soluble
102 Y d 0.0000 Buried
103 Y d 0.0000 Buried
104 C d 0.0000 Buried
105 A d 0.0000 Buried
106 R d -0.2978 Soluble
107 T d 0.0000 Buried
108 L d -0.5946 Soluble
109 H d -1.2379 Soluble
110 G d 0.0000 Buried
111 R d -2.2675 Soluble
111A R d -1.6619 Soluble
111B I d 0.7455 Aggregation-prone
111C Y d 1.2478 Aggregation-prone
111D G d 1.4530 Aggregation-prone
111E I d 3.0068 Aggregation-prone
111F V d 2.9761 Aggregation-prone
112G A d 1.8404 Aggregation-prone
112F F d 2.1832 Aggregation-prone
112E N d 0.5704 Aggregation-prone
112D E d 0.3490 Aggregation-prone
112C W d 0.6216 Aggregation-prone
112B F d -0.2954 Soluble
112A T d -0.6886 Soluble
112 Y d 0.0000 Buried
113 F d 0.0000 Buried
114 Y d 0.0000 Buried
115 M d 0.0000 Buried
116 D d -0.3709 Soluble
117 V d -0.0503 Soluble
118 W d 0.0000 Buried
119 G d 0.0000 Buried
120 N d -2.0186 Soluble
121 G d -1.5021 Soluble
122 T d -1.4301 Soluble
123 Q d -1.4876 Soluble
124 V d 0.0000 Buried
125 T d -0.0366 Soluble
126 V d 0.0000 Buried
127 S d -0.2648 Soluble
128 S d -0.4556 Soluble
129 A d -0.1292 Soluble
10 D e -1.6840 Soluble
11 I e -0.6557 Soluble
12 S e -0.1213 Soluble
13 V e 0.0000 Buried
14 A e -0.2997 Soluble
15 P e -0.9432 Soluble
16 G e -1.7309 Soluble
17 E e -2.2348 Soluble
18 T e -1.6863 Soluble
19 A e -1.3817 Soluble
20 R e -1.8753 Soluble
21 I e 0.0000 Buried
22 S e -1.1419 Soluble
23 C e 0.0000 Buried
24 G e -1.7558 Soluble
25 E e -2.2618 Soluble
26 K e -1.3688 Soluble
27 S e 0.0000 Buried
28 L e 0.8889 Aggregation-prone
29 G e 0.1017 Aggregation-prone
36 S e 0.0454 Aggregation-prone
37 R e -0.5370 Soluble
38 A e 0.0000 Buried
39 V e 0.0000 Buried
40 Q e 0.0000 Buried
41 W e 0.0000 Buried
42 Y e 0.0000 Buried
43 Q e -0.6361 Soluble
44 H e -1.3179 Soluble
45 R e -2.0310 Soluble
46 A e -1.3010 Soluble
47 G e -1.4536 Soluble
48 Q e -1.9915 Soluble
49 A e -1.3175 Soluble
50 P e 0.0000 Buried
51 S e -0.4374 Soluble
52 L e 0.0000 Buried
53 I e 0.0000 Buried
54 I e 0.0000 Buried
55 Y e -0.6491 Soluble
56 N e -1.2314 Soluble
57 N e -1.5256 Soluble
65 Q e -2.3447 Soluble
66 D e -2.6820 Soluble
67 R e -2.0569 Soluble
68 P e -1.1226 Soluble
69 S e -1.0020 Soluble
70 G e -0.7539 Soluble
71 I e -0.6439 Soluble
72 P e -1.3022 Soluble
74 E e -2.2438 Soluble
75 R e -1.5469 Soluble
76 F e 0.0000 Buried
77 S e -1.3505 Soluble
78 G e -1.0108 Soluble
79 S e -0.5110 Soluble
80 P e -0.7725 Soluble
81 D e -0.3599 Soluble
82 S e -0.1409 Soluble
82A P e 0.3564 Aggregation-prone
83 F e 1.6381 Aggregation-prone
84 G e 0.4506 Aggregation-prone
85 T e 0.0788 Aggregation-prone
86 T e -0.3033 Soluble
87 A e 0.0000 Buried
88 T e 0.0000 Buried
89 L e 0.0000 Buried
90 T e -0.8940 Soluble
91 I e 0.0000 Buried
92 T e -1.3889 Soluble
93 S e -1.3065 Soluble
94 V e 0.0000 Buried
95 E e -2.2624 Soluble
96 A e -1.0693 Soluble
97 G e -1.5408 Soluble
98 D e 0.0000 Buried
99 E e -2.0232 Soluble
100 A e 0.0000 Buried
101 D e -1.3072 Soluble
102 Y e 0.0000 Buried
103 Y e 0.0000 Buried
104 C e 0.0000 Buried
105 H e 0.0000 Buried
106 I e 0.0000 Buried
107 W e 0.0000 Buried
108 D e 0.0000 Buried
109 S e -0.5674 Soluble
110 R e -1.3634 Soluble
112 V e -0.2452 Soluble
113 P e -0.5572 Soluble
114 T e -0.2838 Soluble
115 K e -0.0491 Soluble
116 W e 0.3730 Aggregation-prone
117 V e 0.9574 Aggregation-prone
118 F e 0.0000 Buried
119 G e -0.7012 Soluble
120 G e -1.2195 Soluble
121 G e -1.3495 Soluble
122 T e -0.8758 Soluble
123 T e -1.1400 Soluble
124 L e 0.0000 Buried
125 T e -0.5999 Soluble
126 V e 0.1281 Aggregation-prone
127 L e 1.4339 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4366 5.4634 CSV PDB
4.5 -0.479 5.4198 CSV PDB
5.0 -0.533 5.3579 CSV PDB
5.5 -0.5882 5.2881 CSV PDB
6.0 -0.6334 5.2211 CSV PDB
6.5 -0.661 5.1681 CSV PDB
7.0 -0.6705 5.1363 CSV PDB
7.5 -0.6679 5.1221 CSV PDB
8.0 -0.659 5.117 CSV PDB
8.5 -0.6456 5.1153 CSV PDB
9.0 -0.6271 5.1147 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH