Teropavimab / 8c8t

A4DAB261_8c8t_S_U | Source PDB: 8c8t | Chains: S, U | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.7765
Max Score
1.4061
Min Score
-3.2815
Total Score
-166.18
Score CDR
-0.7949
Score non-CDR
-0.7724

Calculation Parameters

Chain Sequence(s) VQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWFSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVDIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKLERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL input.pdb
Selected Chain(s) S (Heavy), U (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.2815
Maximum Score 1.4061
Average Score -0.7765
Total Score -166.1761

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V S 0.1417 Aggregation-prone
3 Q S -0.5631 Soluble
4 L S 0.0000 Buried
5 L S 0.7142 Aggregation-prone
6 Q S 0.0462 Aggregation-prone
7 S S -0.4994 Soluble
8 G S -0.5930 Soluble
9 A S -0.2142 Soluble
11 A S 0.4930 Aggregation-prone
12 V S 1.4061 Aggregation-prone
13 T S 0.0639 Aggregation-prone
14 K S -1.7482 Soluble
15 P S -1.6643 Soluble
16 G S -1.7317 Soluble
17 A S -1.3714 Soluble
18 S S -1.4309 Soluble
19 V S -0.6737 Soluble
20 R S -1.2933 Soluble
21 V S 0.0000 Buried
22 S S -0.4959 Soluble
23 C S 0.0000 Buried
24 E S -0.7189 Soluble
25 A S 0.0000 Buried
26 S S -0.4569 Soluble
27 G S -0.6408 Soluble
28 Y S -0.8718 Soluble
29 N S -1.9626 Soluble
30 I S -1.6987 Soluble
35 R S -3.1943 Soluble
36 D S -2.9593 Soluble
37 Y S -1.1929 Soluble
38 F S -0.0830 Soluble
39 I S 0.0000 Buried
40 H S 0.0000 Buried
41 W S 0.0000 Buried
42 W S 0.0000 Buried
43 R S -0.6543 Soluble
44 Q S -0.9455 Soluble
45 A S -1.1702 Soluble
46 P S -0.9270 Soluble
47 G S -1.4596 Soluble
48 Q S -1.7385 Soluble
49 G S -0.9483 Soluble
50 L S 0.0000 Buried
51 Q S -0.5243 Soluble
52 W S -0.0294 Soluble
53 V S 0.0000 Buried
54 G S 0.0000 Buried
55 W S -0.2006 Soluble
56 I S 0.0000 Buried
57 N S -1.5413 Soluble
58 P S 0.0000 Buried
59 K S -2.7490 Soluble
62 T S -1.6603 Soluble
63 G S -1.6037 Soluble
64 Q S -1.8810 Soluble
65 P S -1.2733 Soluble
66 N S -1.6336 Soluble
67 N S -1.6675 Soluble
68 P S -1.9229 Soluble
69 R S -3.0384 Soluble
70 Q S -2.6089 Soluble
71 F S 0.0000 Buried
72 Q S -2.7393 Soluble
74 G S -2.0260 Soluble
75 R S -1.9342 Soluble
76 V S 0.0000 Buried
77 S S -1.0807 Soluble
78 L S 0.0000 Buried
79 T S -0.7699 Soluble
80 R S -1.3437 Soluble
81 H S -1.2131 Soluble
82 A S -0.6038 Soluble
83 S S 0.2313 Aggregation-prone
84 W S 1.1509 Aggregation-prone
85 F S -0.3199 Soluble
86 S S -0.4835 Soluble
87 F S 0.0000 Buried
88 Y S -0.6439 Soluble
89 M S 0.0000 Buried
90 D S -1.3307 Soluble
91 L S 0.0000 Buried
92 K S -2.1652 Soluble
93 A S -1.6633 Soluble
94 L S 0.0000 Buried
95 R S -2.8254 Soluble
96 S S -2.1730 Soluble
97 D S -2.3997 Soluble
98 D S 0.0000 Buried
99 T S -0.8389 Soluble
100 A S 0.0000 Buried
101 V S -0.4940 Soluble
102 Y S 0.0000 Buried
103 F S 0.0000 Buried
104 C S 0.0000 Buried
105 A S 0.0000 Buried
106 R S 0.0000 Buried
107 Q S -0.5112 Soluble
108 R S -1.0014 Soluble
109 S S -0.9218 Soluble
110 D S -1.5576 Soluble
112 Y S -0.2496 Soluble
113 W S -0.2016 Soluble
114 D S 0.0000 Buried
115 F S 0.0000 Buried
116 D S -0.8173 Soluble
117 V S -0.4486 Soluble
118 W S -0.1681 Soluble
119 G S 0.0000 Buried
120 S S -0.5575 Soluble
121 G S -0.6309 Soluble
122 T S 0.0000 Buried
123 Q S -1.0344 Soluble
124 V S 0.0000 Buried
125 T S 0.0689 Aggregation-prone
126 V S -0.3925 Soluble
1 D U -1.8457 Soluble
2 I U -0.7333 Soluble
3 Q U -1.4661 Soluble
4 M U -0.8306 Soluble
5 T U -0.6709 Soluble
6 Q U -0.4519 Soluble
7 S U -0.4877 Soluble
8 P U -0.5628 Soluble
9 S U -0.8367 Soluble
10 S U -1.0197 Soluble
11 L U -0.4710 Soluble
12 S U -0.3658 Soluble
13 A U 0.0000 Buried
14 S U 0.1119 Aggregation-prone
15 V U 0.6434 Aggregation-prone
16 G U -1.3263 Soluble
17 D U -2.0962 Soluble
18 T U -1.3646 Soluble
19 V U -0.5880 Soluble
20 T U -0.0689 Soluble
21 I U 0.0000 Buried
22 T U -0.6273 Soluble
23 C U 0.0000 Buried
24 Q U -1.6715 Soluble
25 A U 0.0000 Buried
27 N U -1.9515 Soluble
28 G U -0.5894 Soluble
38 Y U 0.4604 Aggregation-prone
39 L U 0.0000 Buried
40 N U 0.0000 Buried
41 W U 0.0000 Buried
42 Y U 0.0000 Buried
43 Q U 0.0000 Buried
44 Q U -2.2198 Soluble
45 R U -3.2815 Soluble
46 R U -3.2234 Soluble
47 G U -2.5367 Soluble
48 K U -3.1310 Soluble
49 A U -1.8367 Soluble
50 P U 0.0000 Buried
51 K U -1.9983 Soluble
52 L U 0.0000 Buried
53 L U 0.0000 Buried
54 I U 0.0000 Buried
55 Y U 0.0552 Aggregation-prone
56 D U -0.3076 Soluble
57 G U 0.0000 Buried
65 S U -1.7598 Soluble
66 K U -1.5043 Soluble
67 L U -0.6085 Soluble
68 E U -1.2027 Soluble
69 R U -2.1042 Soluble
70 G U -1.2582 Soluble
71 V U -0.7815 Soluble
72 P U -0.5240 Soluble
74 S U -0.7124 Soluble
75 R U -1.0753 Soluble
76 F U 0.0000 Buried
77 S U -0.9620 Soluble
78 G U -1.7529 Soluble
79 R U -2.9136 Soluble
80 R U -2.8252 Soluble
83 W U -0.9159 Soluble
84 G U -1.4546 Soluble
85 Q U -2.1435 Soluble
86 E U -1.9207 Soluble
87 Y U 0.0000 Buried
88 N U -1.2535 Soluble
89 L U 0.0000 Buried
90 T U -0.6689 Soluble
91 I U 0.0000 Buried
92 N U -2.1840 Soluble
93 N U -2.2659 Soluble
94 L U 0.0000 Buried
95 Q U -1.2665 Soluble
96 P U -0.8095 Soluble
97 E U -2.0370 Soluble
98 D U 0.0000 Buried
99 I U -0.5850 Soluble
100 A U -1.4727 Soluble
101 T U -1.4502 Soluble
102 Y U 0.0000 Buried
103 F U 0.0000 Buried
104 C U 0.0000 Buried
105 Q U 0.0000 Buried
106 V U 0.0000 Buried
107 Y U 0.7426 Aggregation-prone
116 E U 0.2148 Aggregation-prone
117 F U 1.2090 Aggregation-prone
118 V U 0.0000 Buried
119 V U 0.1212 Aggregation-prone
120 P U -0.9600 Soluble
121 G U -0.9724 Soluble
122 T U 0.0000 Buried
123 R U -2.2760 Soluble
124 L U 0.0000 Buried
125 D U -0.4342 Soluble
126 L U 1.3418 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.7654 3.2236 CSV PDB
4.5 -0.8029 3.2236 CSV PDB
5.0 -0.8453 3.2236 CSV PDB
5.5 -0.8854 3.2236 CSV PDB
6.0 -0.9162 3.2236 CSV PDB
6.5 -0.9336 3.2236 CSV PDB
7.0 -0.9392 3.2236 CSV PDB
7.5 -0.9381 3.2236 CSV PDB
8.0 -0.9328 3.2236 CSV PDB
8.5 -0.9222 3.2236 CSV PDB
9.0 -0.9042 3.2236 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH