Teropavimab / 5v8l

A4DAB261_5v8l_H_L | Source PDB: 5v8l | Chains: H, L | Done
99.55
Yes
10 Å
Yes
Avg A4D Score
-0.7253
Max Score
1.4984
Min Score
-3.3053
Total Score
-158.85
Score CDR
-0.723
Score non-CDR
-0.7259

Calculation Parameters

Chain Sequence(s) QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVDIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKLERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.3053
Maximum Score 1.4984
Average Score -0.7253
Total Score -158.8496

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q H -0.8427 Soluble
2 V H 0.3958 Aggregation-prone
3 Q H -0.1315 Soluble
4 L H 0.0000 Buried
5 L H 1.1391 Aggregation-prone
6 Q H 0.1369 Aggregation-prone
7 S H -0.3948 Soluble
8 G H -0.4805 Soluble
9 A H 0.0614 Aggregation-prone
11 A H 0.5610 Aggregation-prone
12 V H 1.4984 Aggregation-prone
13 T H -0.1281 Soluble
14 K H -1.7326 Soluble
15 P H -1.8191 Soluble
16 G H -1.7959 Soluble
17 A H -1.4089 Soluble
18 S H -1.6125 Soluble
19 V H -1.0128 Soluble
20 R H -2.0383 Soluble
21 V H 0.0000 Buried
22 S H -0.4515 Soluble
23 C H 0.0000 Buried
24 E H -0.2113 Soluble
25 A H -0.4481 Soluble
26 S H -0.5221 Soluble
27 G H -0.9776 Soluble
28 Y H -0.9321 Soluble
29 N H -2.1915 Soluble
30 I H 0.0000 Buried
35 R H -2.7671 Soluble
36 D H -2.8211 Soluble
37 Y H -1.5226 Soluble
38 F H -0.4668 Soluble
39 I H 0.0000 Buried
40 H H 0.0000 Buried
41 W H 0.0000 Buried
42 W H 0.0000 Buried
43 R H -0.4010 Soluble
44 Q H -0.6364 Soluble
45 A H -1.0660 Soluble
46 P H -1.0257 Soluble
47 G H -1.2179 Soluble
48 Q H -1.7627 Soluble
49 G H -1.1275 Soluble
50 L H -0.3773 Soluble
51 Q H -0.5400 Soluble
52 W H -0.0853 Soluble
53 V H 0.0000 Buried
54 G H 0.0000 Buried
55 W H -0.3602 Soluble
56 I H 0.0000 Buried
57 N H -1.5342 Soluble
58 P H 0.0000 Buried
59 K H -2.6015 Soluble
62 T H -1.5770 Soluble
63 G H -1.4767 Soluble
64 Q H -1.6991 Soluble
65 P H -1.1142 Soluble
66 N H -1.6079 Soluble
67 N H -1.6982 Soluble
68 P H -1.8833 Soluble
69 R H -3.0324 Soluble
70 Q H -2.5278 Soluble
71 F H -1.8787 Soluble
72 Q H -2.5868 Soluble
74 G H -1.8537 Soluble
75 R H -1.6408 Soluble
76 V H -1.3012 Soluble
77 S H -1.1411 Soluble
78 L H 0.0000 Buried
79 T H -0.7259 Soluble
80 R H -1.4013 Soluble
81 H H -0.9311 Soluble
82 A H -0.4311 Soluble
83 S H -0.0099 Soluble
84 W H 0.5196 Aggregation-prone
85 D H -0.8346 Soluble
85A F H 0.4453 Aggregation-prone
85B D H -1.4405 Soluble
85C T H -0.9074 Soluble
85D Y H 0.0000 Buried
86 S H -0.5183 Soluble
87 F H 0.0000 Buried
88 Y H -0.6464 Soluble
89 M H 0.0000 Buried
90 D H -1.3236 Soluble
91 L H 0.0000 Buried
92 K H -2.4443 Soluble
93 A H -1.6433 Soluble
94 L H 0.0000 Buried
95 R H -3.0409 Soluble
96 S H -2.1899 Soluble
97 D H -2.4426 Soluble
98 D H 0.0000 Buried
99 T H -0.6971 Soluble
100 A H 0.0000 Buried
101 V H 0.1841 Aggregation-prone
102 Y H 0.0000 Buried
103 F H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H 0.0000 Buried
107 Q H -0.4757 Soluble
108 R H -0.8410 Soluble
109 S H -0.9166 Soluble
110 D H -1.6344 Soluble
112 Y H -0.3254 Soluble
113 W H -0.3306 Soluble
114 D H 0.0000 Buried
115 F H 0.0000 Buried
116 D H 0.0000 Buried
117 V H 0.0000 Buried
118 W H 0.0000 Buried
119 G H 0.0000 Buried
120 S H -0.6011 Soluble
121 G H -0.3987 Soluble
122 T H 0.0000 Buried
123 Q H -0.0793 Soluble
124 V H 0.0000 Buried
125 T H 0.1226 Aggregation-prone
126 V H -0.4471 Soluble
1 D L -1.4797 Soluble
2 I L 0.0879 Aggregation-prone
3 Q L -1.1078 Soluble
4 M L -0.4763 Soluble
5 T L -0.5715 Soluble
6 Q L -0.6765 Soluble
7 S L -0.5682 Soluble
8 P L -0.5214 Soluble
9 S L -0.6216 Soluble
10 S L -0.7777 Soluble
11 L L -0.1251 Soluble
12 S L 0.1678 Aggregation-prone
13 A L 0.2290 Aggregation-prone
14 S L 0.2779 Aggregation-prone
15 V L 0.3872 Aggregation-prone
16 G L -0.8428 Soluble
17 D L -1.1927 Soluble
18 T L -1.2923 Soluble
19 V L 0.0000 Buried
20 T L -0.3776 Soluble
21 I L 0.0000 Buried
22 T L -1.0422 Soluble
23 C L 0.0000 Buried
24 Q L -2.1615 Soluble
25 A L 0.0000 Buried
27 N L -1.3790 Soluble
28 G L -0.4582 Soluble
38 Y L 0.4508 Aggregation-prone
39 L L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.7480 Soluble
45 R L -2.4752 Soluble
46 R L -3.0123 Soluble
47 G L -2.3587 Soluble
48 K L -2.9722 Soluble
49 A L -1.6593 Soluble
50 P L 0.0000 Buried
51 K L -1.4617 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.3287 Soluble
56 D L -0.7151 Soluble
57 G L 0.0000 Buried
65 S L -1.8792 Soluble
66 K L -2.1937 Soluble
67 L L -1.1946 Soluble
68 E L 0.0000 Buried
69 R L -2.1630 Soluble
70 G L -1.2733 Soluble
71 V L -0.9813 Soluble
72 P L -0.7066 Soluble
74 S L -0.5694 Soluble
75 R L -1.1315 Soluble
76 F L 0.0000 Buried
77 S L -1.1668 Soluble
78 G L -1.9903 Soluble
79 R L -3.3053 Soluble
80 R L -3.0733 Soluble
83 W L -1.2340 Soluble
84 G L -1.2557 Soluble
85 Q L -2.0884 Soluble
86 E L -3.0584 Soluble
87 Y L 0.0000 Buried
88 N L -1.9728 Soluble
89 L L 0.0000 Buried
90 T L -0.9113 Soluble
91 I L 0.0000 Buried
92 N L -1.9683 Soluble
93 N L -1.9935 Soluble
94 L L 0.0000 Buried
95 Q L -0.9784 Soluble
96 P L -0.7214 Soluble
97 E L -1.7678 Soluble
98 D L 0.0000 Buried
99 I L -0.5324 Soluble
100 A L 0.0000 Buried
101 T L 0.0000 Buried
102 Y L 0.0000 Buried
103 F L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 V L 0.0000 Buried
116 Y L 0.5974 Aggregation-prone
117 E L 0.1390 Aggregation-prone
118 F L 1.2540 Aggregation-prone
119 V L 0.5434 Aggregation-prone
120 V L 0.0000 Buried
121 P L -0.5129 Soluble
122 G L -0.8440 Soluble
123 T L 0.0000 Buried
124 R L -1.2314 Soluble
125 L L 0.0000 Buried
126 D L -0.1065 Soluble
127 L L 1.3028 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5973 5.0035 CSV PDB
4.5 -0.6401 4.7158 CSV PDB
5.0 -0.6906 4.3645 CSV PDB
5.5 -0.7411 3.9752 CSV PDB
6.0 -0.7833 3.5772 CSV PDB
6.5 -0.8115 3.1839 CSV PDB
7.0 -0.8264 3.0485 CSV PDB
7.5 -0.833 3.0001 CSV PDB
8.0 -0.8343 2.9798 CSV PDB
8.5 -0.8296 2.9725 CSV PDB
9.0 -0.8171 2.9698 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH