Porgaviximab / 5kel

A4DAB211_5kel_H_L | Source PDB: 5kel | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.6716
Max Score
2.0046
Min Score
-2.9084
Total Score
-152.46
Score CDR
-0.4416
Score non-CDR
-0.7333

Calculation Parameters

Chain Sequence(s) EVQLQESGGGLMQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKRSVYLQMNTLRAEDTGIYYCTRGNGNYRAMDYWGQGTSVTVSDIQMTQSPASLSVSVGETVSITCRASENIYSSLAWYQQKQGKSPQLLVYSATILADGVPSRFSGSGSGTQYSLKINSLQSEDFGTYYCQHFWGTPYTFGGGTKLEIK input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.9084
Maximum Score 2.0046
Average Score -0.6716
Total Score -152.4635

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E H -2.0512 Soluble
2 V H -1.2995 Soluble
3 Q H -1.7864 Soluble
4 L H 0.0000 Buried
5 Q H -1.5904 Soluble
6 E H -1.1200 Soluble
7 S H -0.9624 Soluble
8 G H -0.9487 Soluble
9 G H -0.5758 Soluble
11 G H 0.2938 Aggregation-prone
12 L H 1.1303 Aggregation-prone
13 M H -0.0609 Soluble
14 Q H -1.3096 Soluble
15 P H -1.6751 Soluble
16 G H -1.6666 Soluble
17 G H -1.2482 Soluble
18 S H -1.4320 Soluble
19 M H -1.1493 Soluble
20 K H -2.0159 Soluble
21 L H 0.0000 Buried
22 S H -0.6763 Soluble
23 C H 0.0000 Buried
24 V H -0.4218 Soluble
25 A H 0.0000 Buried
26 S H -1.2199 Soluble
27 G H -1.1577 Soluble
28 F H -0.8377 Soluble
29 T H -0.6599 Soluble
30 F H 0.0000 Buried
35 S H -1.2074 Soluble
36 N H -1.5788 Soluble
37 Y H 0.0000 Buried
38 W H -0.5534 Soluble
39 M H 0.0000 Buried
40 N H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H -0.9251 Soluble
45 S H -1.6282 Soluble
46 P H -1.6798 Soluble
47 E H -2.8793 Soluble
48 K H -2.9084 Soluble
49 G H -1.7033 Soluble
50 L H 0.0000 Buried
51 E H -0.6759 Soluble
52 W H 0.0000 Buried
53 V H 0.0000 Buried
54 A H 0.0000 Buried
55 E H 0.0000 Buried
56 I H 0.0000 Buried
57 R H -0.8624 Soluble
58 L H -1.3398 Soluble
59 K H -2.2559 Soluble
60 S H -1.7161 Soluble
61 N H -1.8138 Soluble
62 N H -2.0330 Soluble
63 Y H -0.9052 Soluble
64 A H -0.7166 Soluble
65 T H -0.3376 Soluble
66 H H -1.0527 Soluble
67 Y H -1.3589 Soluble
68 A H -1.6476 Soluble
69 E H -2.7049 Soluble
70 S H -1.6882 Soluble
71 V H 0.0000 Buried
72 K H -2.8994 Soluble
74 G H -1.9542 Soluble
75 R H -1.9203 Soluble
76 F H 0.0000 Buried
77 T H -0.8909 Soluble
78 I H -0.1818 Soluble
79 S H -0.2542 Soluble
80 R H -0.6405 Soluble
81 D H -1.4283 Soluble
82 D H -1.8490 Soluble
83 S H -1.7014 Soluble
84 K H -2.3649 Soluble
85 R H -1.8812 Soluble
86 S H -1.0771 Soluble
87 V H 0.0000 Buried
88 Y H -0.3115 Soluble
89 L H 0.0000 Buried
90 Q H -1.2889 Soluble
91 M H 0.0000 Buried
92 N H -1.8373 Soluble
93 T H -1.5891 Soluble
94 L H 0.0000 Buried
95 R H -2.7737 Soluble
96 A H -2.0115 Soluble
97 E H -2.1916 Soluble
98 D H 0.0000 Buried
99 T H -0.3289 Soluble
100 G H 0.0000 Buried
101 I H 0.1533 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 T H 0.0000 Buried
106 R H 0.0000 Buried
107 G H 0.0000 Buried
108 N H -1.3231 Soluble
109 G H -1.3651 Soluble
110 N H -1.5014 Soluble
112 Y H -0.5644 Soluble
113 R H -0.8831 Soluble
114 A H 0.0000 Buried
115 M H 0.0000 Buried
116 D H -0.4871 Soluble
117 Y H -0.0580 Soluble
118 W H -0.0946 Soluble
119 G H 0.0000 Buried
120 Q H -1.6307 Soluble
121 G H -0.9855 Soluble
122 T H -0.6630 Soluble
123 S H -0.0650 Soluble
124 V H 0.0000 Buried
125 T H -0.0388 Soluble
126 V H -0.6022 Soluble
127 S H -0.6854 Soluble
1 D L -1.9801 Soluble
2 I L -1.5400 Soluble
3 Q L -1.8446 Soluble
4 M L -1.1411 Soluble
5 T L -0.6709 Soluble
6 Q L 0.0000 Buried
7 S L -0.5430 Soluble
8 P L -0.3644 Soluble
9 A L -0.4552 Soluble
10 S L -0.5472 Soluble
11 L L -0.2207 Soluble
12 S L -0.3092 Soluble
13 V L 0.0000 Buried
14 S L 0.3674 Aggregation-prone
15 V L 1.2144 Aggregation-prone
16 G L -0.1326 Soluble
17 E L -0.4117 Soluble
18 T L -0.8235 Soluble
19 V L 0.0000 Buried
20 S L -0.7331 Soluble
21 I L 0.0000 Buried
22 T L -0.6889 Soluble
23 C L 0.0000 Buried
24 R L -1.8203 Soluble
25 A L -1.5892 Soluble
26 S L -1.6829 Soluble
27 E L -1.7648 Soluble
28 N L 0.0000 Buried
29 I L 1.8332 Aggregation-prone
36 Y L 1.3717 Aggregation-prone
37 S L 0.5635 Aggregation-prone
38 S L 0.0000 Buried
39 L L 0.0000 Buried
40 A L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.2544 Soluble
45 K L -1.8727 Soluble
46 Q L -1.9854 Soluble
47 G L -1.7810 Soluble
48 K L -2.0003 Soluble
49 S L -1.2652 Soluble
50 P L 0.0000 Buried
51 Q L -0.7388 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 V L 0.0000 Buried
55 Y L 0.5375 Aggregation-prone
56 S L 0.5414 Aggregation-prone
57 A L 0.4797 Aggregation-prone
65 T L 0.8761 Aggregation-prone
66 I L 2.0046 Aggregation-prone
67 L L 0.8456 Aggregation-prone
68 A L 0.0000 Buried
69 D L -1.6137 Soluble
70 G L -1.2154 Soluble
71 V L -0.5964 Soluble
72 P L -0.6269 Soluble
74 S L -0.5569 Soluble
75 R L -1.1184 Soluble
76 F L 0.0000 Buried
77 S L -0.5476 Soluble
78 G L -0.3483 Soluble
79 S L -0.8350 Soluble
80 G L -1.1438 Soluble
83 S L -0.7169 Soluble
84 G L -0.7165 Soluble
85 T L -1.6198 Soluble
86 Q L -2.0657 Soluble
87 Y L 0.0000 Buried
88 S L -0.9049 Soluble
89 L L 0.0000 Buried
90 K L -1.3843 Soluble
91 I L 0.0000 Buried
92 N L -1.8389 Soluble
93 S L -1.0030 Soluble
94 L L 0.0000 Buried
95 Q L -1.1085 Soluble
96 S L -0.7843 Soluble
97 E L -2.1300 Soluble
98 D L 0.0000 Buried
99 F L -0.6331 Soluble
100 G L -1.2152 Soluble
101 T L -0.9748 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 H L 0.0000 Buried
107 F L 0.0000 Buried
108 W L 0.6636 Aggregation-prone
109 G L -0.0081 Soluble
114 T L -0.3210 Soluble
115 P L -0.6487 Soluble
116 Y L -0.2124 Soluble
117 T L -0.4132 Soluble
118 F L -0.1163 Soluble
119 G L 0.0000 Buried
120 G L -1.0345 Soluble
121 G L -0.8154 Soluble
122 T L 0.0000 Buried
123 K L -1.3338 Soluble
124 L L 0.0000 Buried
125 E L -0.4673 Soluble
126 I L 0.9348 Aggregation-prone
127 K L -0.6835 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.661 3.1904 CSV PDB
4.5 -0.6948 3.144 CSV PDB
5.0 -0.7368 3.0926 CSV PDB
5.5 -0.7773 3.0394 CSV PDB
6.0 -0.8045 2.9856 CSV PDB
6.5 -0.8091 2.9318 CSV PDB
7.0 -0.7908 2.8782 CSV PDB
7.5 -0.7572 2.8256 CSV PDB
8.0 -0.7154 2.776 CSV PDB
8.5 -0.669 2.7337 CSV PDB
9.0 -0.6192 2.7043 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH