Garadacimab / 8r8d

A4DAB125_8r8d_E_I | Source PDB: 8r8d | Chains: E, I | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5744
Max Score
2.7416
Min Score
-3.0627
Total Score
-135.57
Score CDR
—
Score non-CDR
—

Calculation Parameters

Chain Sequence(s) VQLLESGGGLVQPGGSLRLSCAASGFTFSKYIMQWVRQAPGKGLEWVSGIDIPTKGTVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARALPRSGYLISPHYYYYALDVWGQGTTVTVSSSVLTQPPSASGTPGQRVTISCSGSSSNIGRNYVYWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDASLRGVFGGGTKLTVL input.pdb
Selected Chain(s) E (Heavy), I (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0627
Maximum Score 2.7416
Average Score -0.5744
Total Score -135.5673

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V E 1.0429 Aggregation-prone
3 Q E -0.2464 Soluble
4 L E 0.0000 Buried
5 L E 0.5242 Aggregation-prone
6 E E -0.0971 Soluble
7 S E -0.6865 Soluble
8 G E -1.1003 Soluble
9 G E -0.5378 Soluble
11 G E 0.3626 Aggregation-prone
12 L E 1.0689 Aggregation-prone
13 V E 0.0000 Buried
14 Q E -1.4883 Soluble
15 P E -1.8093 Soluble
16 G E -1.6570 Soluble
17 G E -1.2430 Soluble
18 S E -1.3422 Soluble
19 L E -0.9991 Soluble
20 R E -2.1884 Soluble
21 L E 0.0000 Buried
22 S E -0.5891 Soluble
23 C E 0.0000 Buried
24 A E -0.2955 Soluble
25 A E 0.0000 Buried
26 S E -0.0786 Soluble
27 G E 0.0429 Aggregation-prone
28 F E -0.0059 Soluble
29 T E -0.4800 Soluble
30 F E 0.0000 Buried
35 S E -1.4600 Soluble
36 K E -1.6532 Soluble
37 Y E -0.7735 Soluble
38 I E 0.0000 Buried
39 M E 0.0000 Buried
40 Q E 0.0000 Buried
41 W E 0.0000 Buried
42 V E 0.0000 Buried
43 R E 0.0000 Buried
44 Q E -0.8331 Soluble
45 A E -1.2472 Soluble
46 P E -1.0237 Soluble
47 G E -1.4689 Soluble
48 K E -2.2624 Soluble
49 G E -1.3892 Soluble
50 L E 0.0000 Buried
51 E E -0.8868 Soluble
52 W E 0.0000 Buried
53 V E 0.0000 Buried
54 S E 0.0000 Buried
55 G E 0.0000 Buried
56 I E -0.9123 Soluble
57 D E -2.1753 Soluble
58 I E 0.0000 Buried
59 P E -1.1697 Soluble
62 T E -0.9264 Soluble
63 K E -1.6287 Soluble
64 G E -1.4830 Soluble
65 T E -0.9569 Soluble
66 V E 0.0000 Buried
67 Y E -0.9942 Soluble
68 A E -1.5430 Soluble
69 D E -2.5221 Soluble
70 S E -1.6704 Soluble
71 V E 0.0000 Buried
72 K E -2.5498 Soluble
74 G E -1.6547 Soluble
75 R E 0.0000 Buried
76 F E 0.0000 Buried
77 T E -0.8417 Soluble
78 I E 0.0000 Buried
79 S E -0.6384 Soluble
80 R E -1.3185 Soluble
81 D E -1.8039 Soluble
82 N E -2.1196 Soluble
83 S E -1.8232 Soluble
84 K E -2.4779 Soluble
85 N E -1.8655 Soluble
86 T E 0.0000 Buried
87 L E 0.0000 Buried
88 Y E 0.0000 Buried
89 L E 0.0000 Buried
90 Q E -1.2994 Soluble
91 M E 0.0000 Buried
92 N E -1.4978 Soluble
93 S E -1.3678 Soluble
94 L E 0.0000 Buried
95 R E -2.7708 Soluble
96 A E -2.0320 Soluble
97 E E -2.3372 Soluble
98 D E 0.0000 Buried
99 T E -0.7563 Soluble
100 A E 0.0000 Buried
101 V E -0.0625 Soluble
102 Y E 0.0000 Buried
103 Y E 0.0000 Buried
104 C E 0.0000 Buried
105 A E 0.0000 Buried
106 R E 0.0000 Buried
107 A E 0.0000 Buried
108 L E -0.0537 Soluble
109 P E -0.8171 Soluble
110 R E -0.4653 Soluble
111 S E -0.1758 Soluble
111A G E 0.6614 Aggregation-prone
111B Y E 2.0960 Aggregation-prone
111C L E 2.7416 Aggregation-prone
111D I E 2.5743 Aggregation-prone
112E S E 1.3408 Aggregation-prone
112D P E -0.1463 Soluble
112C H E -0.2077 Soluble
112B Y E 1.0477 Aggregation-prone
112A Y E 0.4833 Aggregation-prone
112 Y E 0.4741 Aggregation-prone
113 Y E 0.2352 Aggregation-prone
114 A E 0.0000 Buried
115 L E 0.0000 Buried
116 D E -0.4510 Soluble
117 V E -0.1014 Soluble
118 W E 0.0000 Buried
119 G E 0.0000 Buried
120 Q E -1.1634 Soluble
121 G E -0.5694 Soluble
122 T E -0.3828 Soluble
123 T E -0.0403 Soluble
124 V E 0.0000 Buried
125 T E 0.0415 Aggregation-prone
126 V E 0.0000 Buried
127 S E -0.8503 Soluble
128 S E -0.5889 Soluble
2 S I 0.5220 Aggregation-prone
3 V I 1.5487 Aggregation-prone
4 L I 0.0000 Buried
5 T I 0.0049 Aggregation-prone
6 Q I -0.5005 Soluble
7 P I -0.7274 Soluble
8 P I -0.9650 Soluble
9 S I -1.1903 Soluble
11 A I -0.8540 Soluble
12 S I -0.5967 Soluble
13 G I 0.0000 Buried
14 T I -0.6116 Soluble
15 P I -1.5956 Soluble
16 G I -2.0406 Soluble
17 Q I -2.5910 Soluble
18 R I -2.8352 Soluble
19 V I 0.0000 Buried
20 T I -0.5899 Soluble
21 I I 0.0000 Buried
22 S I -0.3723 Soluble
23 C I 0.0000 Buried
24 S I -0.2245 Soluble
25 G I -0.1305 Soluble
26 S I -0.5463 Soluble
27 S I -1.1972 Soluble
28 S I -0.8920 Soluble
29 N I 0.0000 Buried
30 I I 0.0000 Buried
35 G I -1.7212 Soluble
36 R I -2.2949 Soluble
37 N I -1.2913 Soluble
38 Y I -0.3391 Soluble
39 V I 0.0000 Buried
40 Y I 0.0000 Buried
41 W I 0.0000 Buried
42 Y I 0.0000 Buried
43 Q I 0.0000 Buried
44 Q I 0.0000 Buried
45 L I -0.3434 Soluble
46 P I -0.3599 Soluble
47 G I -0.6191 Soluble
48 T I -0.6157 Soluble
49 A I -0.6768 Soluble
50 P I 0.0000 Buried
51 K I -1.3152 Soluble
52 L I 0.0000 Buried
53 L I 0.0000 Buried
54 I I 0.0000 Buried
55 Y I 0.0000 Buried
56 S I -0.7407 Soluble
57 N I -1.2574 Soluble
65 N I -2.0163 Soluble
66 Q I -1.9775 Soluble
67 R I -1.8832 Soluble
68 P I 0.0000 Buried
69 S I -1.0406 Soluble
70 G I -0.8711 Soluble
71 V I -1.0012 Soluble
72 P I -1.3258 Soluble
74 D I -2.3012 Soluble
75 R I -1.5010 Soluble
76 F I 0.0000 Buried
77 S I -1.2983 Soluble
78 G I -1.1928 Soluble
79 S I -1.1403 Soluble
80 K I -1.1253 Soluble
83 S I -0.8459 Soluble
84 G I -1.2686 Soluble
85 T I -1.1177 Soluble
86 S I -0.7245 Soluble
87 A I 0.0000 Buried
88 S I -0.6120 Soluble
89 L I 0.0000 Buried
90 A I -0.6485 Soluble
91 I I 0.0000 Buried
92 S I -1.9379 Soluble
93 G I -1.8766 Soluble
94 L I 0.0000 Buried
95 R I -3.0627 Soluble
96 S I -2.0586 Soluble
97 E I -2.7641 Soluble
98 D I 0.0000 Buried
99 E I -1.9833 Soluble
100 A I 0.0000 Buried
101 D I 0.0000 Buried
102 Y I 0.0000 Buried
103 Y I 0.0000 Buried
104 C I 0.0000 Buried
105 A I 0.0000 Buried
106 A I 0.0000 Buried
107 W I 0.0000 Buried
108 D I -0.4696 Soluble
109 A I -0.4832 Soluble
113 S I -0.3148 Soluble
114 L I -0.2474 Soluble
115 R I -0.6307 Soluble
116 G I -0.2317 Soluble
117 V I 0.3043 Aggregation-prone
118 F I 0.2372 Aggregation-prone
119 G I 0.0000 Buried
120 G I -0.6650 Soluble
121 G I -1.0664 Soluble
122 T I 0.0000 Buried
123 K I -2.0944 Soluble
124 L I 0.0000 Buried
125 T I -0.6772 Soluble
126 V I -0.5541 Soluble
127 L I 1.1779 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.632 3.3107 CSV PDB
4.5 -0.659 3.3146 CSV PDB
5.0 -0.6891 3.3253 CSV PDB
5.5 -0.716 3.3486 CSV PDB
6.0 -0.7333 3.3838 CSV PDB
6.5 -0.7372 3.4175 CSV PDB
7.0 -0.7298 3.4383 CSV PDB
7.5 -0.7156 3.4472 CSV PDB
8.0 -0.6977 3.4502 CSV PDB
8.5 -0.6759 3.4505 CSV PDB
9.0 -0.6496 3.4485 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH