Sipavibart / 7zr7

A4DAB241_7zr7_H_L | Source PDB: 7zr7 | Chains: H, L | Done
98.29
Yes
10 Å
Yes
Avg A4D Score
-0.6187
Max Score
1.7548
Min Score
-3.0641
Total Score
-144.15
Score CDR
-0.435
Score non-CDR
-0.6754

Calculation Parameters

Chain Sequence(s) EVQLLETGGGLVQPGRSLRLSCAASGFPFDDYAIHWVRLAPGKGLEWVSSISWDSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGAFPGYSSGWYYGLDVWGQGATVTVSSSVVTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIFEVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGNKGVFGGGTKLTVL input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0641
Maximum Score 1.7548
Average Score -0.6187
Total Score -144.1533

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E H -1.9445 Soluble
2 V H -0.9559 Soluble
3 Q H -1.0084 Soluble
4 L H 0.0000 Buried
5 L H 0.4148 Aggregation-prone
6 E H 0.0000 Buried
7 T H -0.5106 Soluble
8 G H -0.9917 Soluble
9 G H -0.5752 Soluble
11 G H 0.2990 Aggregation-prone
12 L H 1.0849 Aggregation-prone
13 V H 0.0000 Buried
14 Q H -1.8170 Soluble
15 P H -2.2550 Soluble
16 G H -2.3663 Soluble
17 R H -2.8468 Soluble
18 S H -1.9630 Soluble
19 L H -1.4436 Soluble
20 R H -2.2428 Soluble
21 L H 0.0000 Buried
22 S H -0.5725 Soluble
23 C H 0.0000 Buried
24 A H -0.2271 Soluble
25 A H 0.0000 Buried
26 S H -0.9787 Soluble
27 G H -1.1436 Soluble
28 F H -0.9099 Soluble
29 P H -1.2619 Soluble
30 F H 0.0000 Buried
35 D H -3.0641 Soluble
36 D H -2.1516 Soluble
37 Y H -0.6384 Soluble
38 A H 0.0000 Buried
39 I H 0.0000 Buried
40 H H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 L H -0.3541 Soluble
45 A H -1.0866 Soluble
46 P H -1.1241 Soluble
47 G H -1.3934 Soluble
48 K H -2.2049 Soluble
49 G H -1.3096 Soluble
50 L H 0.0000 Buried
51 E H -0.8128 Soluble
52 W H 0.0000 Buried
53 V H 0.0000 Buried
54 S H 0.0000 Buried
55 S H 0.0000 Buried
56 I H 0.0000 Buried
57 S H 0.0000 Buried
58 W H -1.4394 Soluble
59 D H -2.3269 Soluble
62 S H -0.9614 Soluble
63 G H -0.7602 Soluble
64 S H -0.1346 Soluble
65 I H 0.6224 Aggregation-prone
66 G H -0.3425 Soluble
67 Y H -1.0103 Soluble
68 A H -1.6840 Soluble
69 D H -2.5036 Soluble
70 S H -1.6836 Soluble
71 V H 0.0000 Buried
72 K H -2.6021 Soluble
74 G H -1.6929 Soluble
75 R H -1.4830 Soluble
76 F H 0.0000 Buried
77 T H -0.8146 Soluble
78 I H 0.0000 Buried
79 S H -0.5647 Soluble
80 R H -1.2046 Soluble
81 D H -1.9741 Soluble
82 N H -2.4159 Soluble
83 A H -1.6164 Soluble
84 K H -2.4273 Soluble
85 N H -1.9708 Soluble
86 S H 0.0000 Buried
87 L H 0.0000 Buried
88 Y H 0.0000 Buried
89 L H 0.0000 Buried
90 Q H -1.5733 Soluble
91 M H 0.0000 Buried
92 N H -1.9165 Soluble
93 S H -1.8684 Soluble
94 L H 0.0000 Buried
95 R H -2.9719 Soluble
96 A H -1.9617 Soluble
97 E H -2.4153 Soluble
98 D H 0.0000 Buried
99 T H -0.7258 Soluble
100 A H 0.0000 Buried
101 L H 0.0488 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 K H 0.0000 Buried
107 G H 0.0000 Buried
108 A H 0.8873 Aggregation-prone
109 F H 1.7548 Aggregation-prone
110 P H 0.3722 Aggregation-prone
111 G H 0.4591 Aggregation-prone
111A Y H 0.2182 Aggregation-prone
111B S H -0.2327 Soluble
112C S H 0.0000 Buried
112B G H 0.0000 Buried
112A W H 0.0000 Buried
112 Y H 0.7792 Aggregation-prone
113 Y H 0.6886 Aggregation-prone
114 G H 0.0000 Buried
115 L H 0.0000 Buried
116 D H -0.7287 Soluble
117 V H -0.3863 Soluble
118 W H 0.0000 Buried
119 G H 0.0000 Buried
120 Q H -1.4649 Soluble
121 G H 0.0000 Buried
122 A H 0.0000 Buried
123 T H -0.0665 Soluble
124 V H 0.0000 Buried
125 T H -0.1514 Soluble
126 V H 0.0000 Buried
127 S H -0.8423 Soluble
128 S H -0.6725 Soluble
2 S L 0.4302 Aggregation-prone
3 V L 1.5932 Aggregation-prone
4 V L 0.0000 Buried
5 T L 0.1550 Aggregation-prone
6 Q L 0.0000 Buried
7 P L -0.6225 Soluble
8 P L -1.0825 Soluble
9 S L -1.0034 Soluble
11 A L -0.8125 Soluble
12 S L -0.2762 Soluble
13 G L -0.0268 Soluble
14 S L 0.5264 Aggregation-prone
15 L L 0.8365 Aggregation-prone
16 G L -0.4000 Soluble
17 Q L -1.0895 Soluble
18 S L -0.9322 Soluble
19 V L 0.0000 Buried
20 T L -0.2262 Soluble
21 I L 0.0000 Buried
22 S L -0.2258 Soluble
23 C L 0.0000 Buried
24 T L -0.2973 Soluble
25 G L 0.0000 Buried
26 T L -0.4600 Soluble
27 S L -0.7561 Soluble
28 S L -0.5445 Soluble
29 D L 0.0000 Buried
30 V L 0.0000 Buried
31 G L -1.1932 Soluble
35 G L -0.7945 Soluble
36 Y L -0.4404 Soluble
37 N L -1.1385 Soluble
38 Y L -0.3105 Soluble
39 V L 0.0000 Buried
40 S L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 H L -1.5346 Soluble
46 P L -1.2382 Soluble
47 G L -1.6169 Soluble
48 K L -2.4295 Soluble
49 A L -1.5028 Soluble
50 P L 0.0000 Buried
51 K L -1.2443 Soluble
52 L L -0.6852 Soluble
53 M L 0.0000 Buried
54 I L 0.0000 Buried
55 F L -0.6460 Soluble
56 E L -0.8843 Soluble
57 V L 0.0000 Buried
65 S L -1.4045 Soluble
66 K L -1.9529 Soluble
67 R L -2.1920 Soluble
68 P L -1.1023 Soluble
69 S L -0.8083 Soluble
70 G L -0.8644 Soluble
71 V L -1.1207 Soluble
72 P L -1.3358 Soluble
74 D L -2.2423 Soluble
75 R L -1.3908 Soluble
76 F L 0.0000 Buried
77 S L -1.1577 Soluble
78 G L -0.8234 Soluble
79 S L -0.8865 Soluble
80 K L -1.1852 Soluble
83 S L -0.9226 Soluble
84 G L -1.1921 Soluble
85 N L -1.2938 Soluble
86 T L -0.8490 Soluble
87 A L 0.0000 Buried
88 S L -0.3623 Soluble
89 L L 0.0000 Buried
90 T L -0.3094 Soluble
91 V L 0.0000 Buried
92 S L -1.0435 Soluble
93 G L -0.9616 Soluble
94 L L 0.0000 Buried
95 Q L -1.0157 Soluble
96 A L -0.9149 Soluble
97 E L -2.2885 Soluble
98 D L 0.0000 Buried
99 E L -1.9282 Soluble
100 A L 0.0000 Buried
101 D L -1.1793 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 S L 0.0000 Buried
106 S L 0.0000 Buried
107 Y L -0.5032 Soluble
108 A L -0.8287 Soluble
109 G L -1.2008 Soluble
114 N L -1.8023 Soluble
115 K L -1.7801 Soluble
116 G L 0.0000 Buried
117 V L 0.0156 Aggregation-prone
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 G L -0.7372 Soluble
121 G L -1.1089 Soluble
122 T L 0.0000 Buried
123 K L -1.8853 Soluble
124 L L 0.0000 Buried
125 T L -0.2494 Soluble
126 V L 0.1440 Aggregation-prone
127 L L 1.4997 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4838 4.5801 CSV PDB
4.5 -0.5265 4.5232 CSV PDB
5.0 -0.5755 4.4589 CSV PDB
5.5 -0.6237 4.3912 CSV PDB
6.0 -0.6633 4.3226 CSV PDB
6.5 -0.687 4.2542 CSV PDB
7.0 -0.6937 4.1872 CSV PDB
7.5 -0.6881 4.1243 CSV PDB
8.0 -0.6739 4.0692 CSV PDB
8.5 -0.6523 4.0244 CSV PDB
9.0 -0.6235 3.9906 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH