Sipavibart / 7zr7

A4DAB241_7zr7_F_G | Source PDB: 7zr7 | Chains: F, G | Done
98.29
Yes
10 Å
Yes
Avg A4D Score
-0.6413
Max Score
1.6764
Min Score
-3.2923
Total Score
-149.42
Score CDR
-0.4627
Score non-CDR
-0.6965

Calculation Parameters

Chain Sequence(s) EVQLLETGGGLVQPGRSLRLSCAASGFPFDDYAIHWVRLAPGKGLEWVSSISWDSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGAFPGYSSGWYYGLDVWGQGATVTVSSSVVTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIFEVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGNKGVFGGGTKLTVL input.pdb
Selected Chain(s) F (Heavy), G (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.2923
Maximum Score 1.6764
Average Score -0.6413
Total Score -149.4211

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E F -1.9409 Soluble
2 V F -0.9489 Soluble
3 Q F -0.9700 Soluble
4 L F 0.0000 Buried
5 L F 0.5535 Aggregation-prone
6 E F 0.0000 Buried
7 T F -0.3858 Soluble
8 G F -0.8126 Soluble
9 G F -0.4671 Soluble
11 G F 0.3018 Aggregation-prone
12 L F 1.0851 Aggregation-prone
13 V F 0.0000 Buried
14 Q F -1.8492 Soluble
15 P F -2.4127 Soluble
16 G F -2.5897 Soluble
17 R F -3.1109 Soluble
18 S F -2.2464 Soluble
19 L F -1.3753 Soluble
20 R F -1.7740 Soluble
21 L F 0.0000 Buried
22 S F -0.4121 Soluble
23 C F 0.0000 Buried
24 A F -0.1658 Soluble
25 A F 0.0000 Buried
26 S F -0.9447 Soluble
27 G F -1.1397 Soluble
28 F F -0.9519 Soluble
29 P F -1.3692 Soluble
30 F F 0.0000 Buried
35 D F -3.2923 Soluble
36 D F -2.5938 Soluble
37 Y F -0.8589 Soluble
38 A F 0.0000 Buried
39 I F 0.0000 Buried
40 H F 0.0000 Buried
41 W F 0.0000 Buried
42 V F 0.0000 Buried
43 R F 0.0000 Buried
44 L F -0.3514 Soluble
45 A F -1.0856 Soluble
46 P F -1.1237 Soluble
47 G F -1.3929 Soluble
48 K F -2.2060 Soluble
49 G F -1.3260 Soluble
50 L F 0.0000 Buried
51 E F -0.8122 Soluble
52 W F 0.0000 Buried
53 V F 0.0000 Buried
54 S F 0.0000 Buried
55 S F 0.0000 Buried
56 I F 0.0000 Buried
57 S F 0.0000 Buried
58 W F -1.6073 Soluble
59 D F -2.4211 Soluble
62 S F -0.9798 Soluble
63 G F -0.7594 Soluble
64 S F -0.1355 Soluble
65 I F 0.6148 Aggregation-prone
66 G F -0.3563 Soluble
67 Y F -1.0659 Soluble
68 A F -1.7261 Soluble
69 D F -2.5470 Soluble
70 S F -1.7472 Soluble
71 V F 0.0000 Buried
72 K F -2.6926 Soluble
74 G F -1.9084 Soluble
75 R F -1.9568 Soluble
76 F F 0.0000 Buried
77 T F -0.9428 Soluble
78 I F 0.0000 Buried
79 S F -0.6036 Soluble
80 R F -1.2914 Soluble
81 D F -2.2178 Soluble
82 N F -2.5537 Soluble
83 A F -1.6720 Soluble
84 K F -2.4769 Soluble
85 N F -1.9699 Soluble
86 S F -1.1040 Soluble
87 L F 0.0000 Buried
88 Y F 0.0000 Buried
89 L F 0.0000 Buried
90 Q F -1.6163 Soluble
91 M F 0.0000 Buried
92 N F -2.7779 Soluble
93 S F -2.3711 Soluble
94 L F 0.0000 Buried
95 R F -3.2475 Soluble
96 A F -2.0473 Soluble
97 E F -2.4746 Soluble
98 D F 0.0000 Buried
99 T F -0.7588 Soluble
100 A F 0.0000 Buried
101 L F 0.0486 Aggregation-prone
102 Y F 0.0000 Buried
103 Y F 0.0000 Buried
104 C F 0.0000 Buried
105 A F 0.0000 Buried
106 K F 0.0000 Buried
107 G F 0.0000 Buried
108 A F 0.8764 Aggregation-prone
109 F F 1.6764 Aggregation-prone
110 P F 0.2242 Aggregation-prone
111 G F 0.3824 Aggregation-prone
111A Y F 0.2160 Aggregation-prone
111B S F -0.2350 Soluble
112C S F 0.0000 Buried
112B G F 0.0000 Buried
112A W F 0.0000 Buried
112 Y F 0.7893 Aggregation-prone
113 Y F 0.6907 Aggregation-prone
114 G F 0.0000 Buried
115 L F 0.0000 Buried
116 D F -0.7271 Soluble
117 V F -0.3836 Soluble
118 W F 0.0000 Buried
119 G F 0.0000 Buried
120 Q F -1.4292 Soluble
121 G F 0.0000 Buried
122 A F 0.0000 Buried
123 T F -0.0651 Soluble
124 V F 0.0000 Buried
125 T F -0.1726 Soluble
126 V F 0.0000 Buried
127 S F -0.8714 Soluble
128 S F -0.6898 Soluble
2 S G 0.4305 Aggregation-prone
3 V G 1.5935 Aggregation-prone
4 V G 0.0000 Buried
5 T G 0.1539 Aggregation-prone
6 Q G 0.0000 Buried
7 P G -0.6191 Soluble
8 P G -1.0879 Soluble
9 S G -1.0051 Soluble
11 A G -0.8128 Soluble
12 S G -0.2619 Soluble
13 G G -0.0113 Soluble
14 S G 0.5490 Aggregation-prone
15 L G 0.8730 Aggregation-prone
16 G G -0.3865 Soluble
17 Q G -1.0630 Soluble
18 S G -0.9208 Soluble
19 V G 0.0000 Buried
20 T G -0.2240 Soluble
21 I G 0.0000 Buried
22 S G -0.2178 Soluble
23 C G 0.0000 Buried
24 T G -0.2922 Soluble
25 G G 0.0000 Buried
26 T G -0.4613 Soluble
27 S G -0.7628 Soluble
28 S G -0.5513 Soluble
29 D G 0.0000 Buried
30 V G 0.0000 Buried
31 G G -1.1900 Soluble
35 G G -0.8062 Soluble
36 Y G -0.4624 Soluble
37 N G -1.1192 Soluble
38 Y G -0.2742 Soluble
39 V G 0.0000 Buried
40 S G 0.0000 Buried
41 W G 0.0000 Buried
42 Y G 0.0000 Buried
43 Q G 0.0000 Buried
44 Q G 0.0000 Buried
45 H G -1.5588 Soluble
46 P G -1.2543 Soluble
47 G G -1.6168 Soluble
48 K G -2.4294 Soluble
49 A G -1.5030 Soluble
50 P G 0.0000 Buried
51 K G -1.2433 Soluble
52 L G -0.6782 Soluble
53 M G 0.0000 Buried
54 I G 0.0000 Buried
55 F G -0.6199 Soluble
56 E G -0.8565 Soluble
57 V G 0.0000 Buried
65 S G -1.3373 Soluble
66 K G -1.9105 Soluble
67 R G -2.1401 Soluble
68 P G -1.0817 Soluble
69 S G -0.7983 Soluble
70 G G -0.8575 Soluble
71 V G -1.1083 Soluble
72 P G -1.3273 Soluble
74 D G -2.2358 Soluble
75 R G -1.3942 Soluble
76 F G 0.0000 Buried
77 S G -1.1231 Soluble
78 G G -0.7767 Soluble
79 S G -0.8361 Soluble
80 K G -1.1102 Soluble
83 S G -0.8902 Soluble
84 G G -1.1797 Soluble
85 N G -1.2943 Soluble
86 T G -0.8329 Soluble
87 A G 0.0000 Buried
88 S G -0.3344 Soluble
89 L G 0.0000 Buried
90 T G -0.3059 Soluble
91 V G 0.0000 Buried
92 S G -1.0399 Soluble
93 G G -0.9643 Soluble
94 L G 0.0000 Buried
95 Q G -0.9882 Soluble
96 A G -0.8957 Soluble
97 E G -2.2772 Soluble
98 D G 0.0000 Buried
99 E G -1.9231 Soluble
100 A G 0.0000 Buried
101 D G -1.2750 Soluble
102 Y G 0.0000 Buried
103 Y G 0.0000 Buried
104 C G 0.0000 Buried
105 S G 0.0000 Buried
106 S G 0.0000 Buried
107 Y G -0.4974 Soluble
108 A G -0.8281 Soluble
109 G G -1.2055 Soluble
114 N G -1.8053 Soluble
115 K G -1.7841 Soluble
116 G G 0.0000 Buried
117 V G 0.0158 Aggregation-prone
118 F G 0.0000 Buried
119 G G 0.0000 Buried
120 G G -0.7417 Soluble
121 G G -1.1369 Soluble
122 T G 0.0000 Buried
123 K G -1.8932 Soluble
124 L G 0.0000 Buried
125 T G -0.2446 Soluble
126 V G 0.1671 Aggregation-prone
127 L G 1.5141 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4835 4.5879 CSV PDB
4.5 -0.5295 4.5299 CSV PDB
5.0 -0.582 4.4587 CSV PDB
5.5 -0.6337 4.3803 CSV PDB
6.0 -0.6762 4.2992 CSV PDB
6.5 -0.7021 4.2177 CSV PDB
7.0 -0.7107 4.1374 CSV PDB
7.5 -0.7073 4.0609 CSV PDB
8.0 -0.696 3.9917 CSV PDB
8.5 -0.6772 3.9322 CSV PDB
9.0 -0.6508 3.8827 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH